Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1165
Gene name
LocationContig_133:8448..10070
Strand-
Gene length (bp)1622
Transcript length (bp)1569
Coding sequence length (bp)1569
Protein length (aa) 523

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01144 CoA_trans Coenzyme A transferase 1.0E-59 48 275
PF01144 CoA_trans Coenzyme A transferase 7.6E-36 310 506

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q29551|SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa GN=OXCT1 PE=1 SV=2 20 521 0.0E+00
sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens GN=OXCT1 PE=1 SV=1 33 521 0.0E+00
sp|Q54JD9|SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum GN=oxct1 PE=3 SV=1 33 521 0.0E+00
sp|B2GV06|SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus GN=Oxct1 PE=1 SV=1 33 521 0.0E+00
sp|Q9D0K2|SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus GN=Oxct1 PE=1 SV=1 33 521 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q29551|SCOT1_PIG Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Sus scrofa GN=OXCT1 PE=1 SV=2 20 521 0.0E+00
sp|P55809|SCOT1_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Homo sapiens GN=OXCT1 PE=1 SV=1 33 521 0.0E+00
sp|Q54JD9|SCOT_DICDI Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Dictyostelium discoideum GN=oxct1 PE=3 SV=1 33 521 0.0E+00
sp|B2GV06|SCOT1_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Rattus norvegicus GN=Oxct1 PE=1 SV=1 33 521 0.0E+00
sp|Q9D0K2|SCOT1_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 1, mitochondrial OS=Mus musculus GN=Oxct1 PE=1 SV=1 33 521 0.0E+00
sp|Q09450|SCOT_CAEEL Probable succinyl-CoA:3-ketoacid coenzyme A transferase, mitochondrial OS=Caenorhabditis elegans GN=C05C10.3 PE=3 SV=1 35 521 3.0E-173
sp|Q9BYC2|SCOT2_HUMAN Succinyl-CoA:3-ketoacid coenzyme A transferase 2, mitochondrial OS=Homo sapiens GN=OXCT2 PE=2 SV=2 1 521 8.0E-164
sp|Q9JJN4|SCO2A_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Mus musculus GN=Oxct2a PE=1 SV=2 35 521 4.0E-162
sp|Q5XIJ9|SCO2A_RAT Succinyl-CoA:3-ketoacid coenzyme A transferase 2A, mitochondrial OS=Rattus norvegicus GN=Oxct2a PE=1 SV=1 1 521 1.0E-161
sp|Q9ESL0|SCO2B_MOUSE Succinyl-CoA:3-ketoacid coenzyme A transferase 2B, mitochondrial OS=Mus musculus GN=Oxct2b PE=2 SV=1 35 521 3.0E-161
sp|P63651|SCOB_MYCBO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=scoB PE=3 SV=1 307 516 4.0E-75
sp|P9WPW2|SCOB_MYCTO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=scoB PE=3 SV=1 307 516 4.0E-75
sp|P9WPW3|SCOB_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=scoB PE=1 SV=1 307 516 4.0E-75
sp|P42316|SCOB_BACSU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Bacillus subtilis (strain 168) GN=scoB PE=1 SV=1 308 518 4.0E-74
sp|B0RVK3|SCOB_XANCB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Xanthomonas campestris pv. campestris (strain B100) GN=lpsJ PE=3 SV=1 305 515 6.0E-69
sp|P0C7I8|SCOB_XANCP Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lpsJ PE=3 SV=1 305 515 6.0E-69
sp|P42315|SCOA_BACSU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Bacillus subtilis (strain 168) GN=scoA PE=1 SV=1 42 296 1.0E-68
sp|P56007|SCOB_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=scoB PE=1 SV=1 308 512 4.0E-68
sp|Q9ZLE4|SCOB_HELPJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit B OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=scoB PE=3 SV=1 308 512 7.0E-68
sp|P56006|SCOA_HELPY Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=scoA PE=1 SV=1 42 286 2.0E-67
sp|Q9ZLE3|SCOA_HELPJ Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=scoA PE=3 SV=1 42 286 4.0E-67
sp|B0RVK4|SCOA_XANCB Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Xanthomonas campestris pv. campestris (strain B100) GN=lpsI PE=3 SV=1 60 291 2.0E-66
sp|P9WPW5|SCOA_MYCTU Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=scoA PE=1 SV=1 55 286 3.0E-66
sp|P9WPW4|SCOA_MYCTO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=scoA PE=3 SV=1 55 286 3.0E-66
sp|P63649|SCOA_MYCBO Probable succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=scoA PE=3 SV=1 55 286 3.0E-66
sp|P0C7I7|SCOA_XANCP Succinyl-CoA:3-ketoacid coenzyme A transferase subunit A OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lpsI PE=3 SV=1 60 291 5.0E-66
sp|O34466|YODR_BACSU Probable coenzyme A transferase subunit beta OS=Bacillus subtilis (strain 168) GN=yodR PE=3 SV=1 302 514 2.0E-61
sp|P23673|CTFB_CLOAB Butyrate--acetoacetate CoA-transferase subunit B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ctfB PE=1 SV=1 303 521 2.0E-55
sp|P0A102|PCAJ_PSEPU 3-oxoadipate CoA-transferase subunit B OS=Pseudomonas putida GN=pcaJ PE=1 SV=2 308 513 1.0E-52
sp|P0A101|PCAJ_PSEPK 3-oxoadipate CoA-transferase subunit B OS=Pseudomonas putida (strain KT2440) GN=pcaJ PE=3 SV=2 308 513 1.0E-52
sp|P76459|ATOA_ECOLI Acetate CoA-transferase subunit beta OS=Escherichia coli (strain K12) GN=atoA PE=1 SV=1 308 519 7.0E-52
sp|Q59091|PCAJ_ACIAD 3-oxoadipate CoA-transferase subunit B OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaJ PE=1 SV=2 308 513 5.0E-48
sp|P44874|ATOA_HAEIN Acetate CoA-transferase subunit beta OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoA PE=3 SV=1 308 521 5.0E-46
sp|Q01103|PCAI_PSEPU 3-oxoadipate CoA-transferase subunit A OS=Pseudomonas putida GN=pcaI PE=1 SV=2 42 272 2.0E-43
sp|Q43973|PCAI_ACIAD 3-oxoadipate CoA-transferase subunit A OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pcaI PE=1 SV=1 42 274 4.0E-42
sp|P76458|ATOD_ECOLI Acetate CoA-transferase subunit alpha OS=Escherichia coli (strain K12) GN=atoD PE=1 SV=1 46 280 2.0E-35
sp|P33752|CTFA_CLOAB Butyrate--acetoacetate CoA-transferase subunit A OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=ctfA PE=1 SV=1 61 275 2.0E-34
sp|O34317|YODS_BACSU Probable coenzyme A transferase subunit alpha OS=Bacillus subtilis (strain 168) GN=yodS PE=3 SV=1 52 287 3.0E-34
sp|P44875|ATOD_HAEIN Acetate CoA-transferase subunit alpha OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=atoD PE=3 SV=1 54 276 5.0E-26
sp|P37766|YDIF_ECOLI Acetate CoA-transferase YdiF OS=Escherichia coli (strain K12) GN=ydiF PE=3 SV=3 141 521 1.0E-11
sp|Q8X5X6|YDIF_ECO57 Acetate CoA-transferase YdiF OS=Escherichia coli O157:H7 GN=ydiF PE=1 SV=1 141 521 4.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0008410 CoA-transferase activity Yes
GO:0016782 transferase activity, transferring sulphur-containing groups No
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1165
MSPLRLAWHAQTRTLGAFARHGTAFAPLLSRPFSVSLRRAEINKVLSSAAEAIRDLQPNSTLLCGGFGLCGVPDT
LINEVLTRPDITGLTAVSNNAGTDNSGLGKLLKTKQVSKMIASYIGENKTFETMYLTGEVELELTPQGTLAERCA
AGGKGIPAFYTPAAIGTVVQTGDLSLKNRADGTPAELSCPKDVKVFNGKPYLLEHSIAGDYAFVKAYRADRLGNC
QFRLAAHNFNGAMGRNAATTIVEAEHIVEPGEIAPEAVHLPGIYVKRVIKSTTEKQIEKFTWAKPDDEAKASALG
TGDAAAKRQRIVQRAAKEFKNGMYANLGIGMPMLAPGFVGPEVEVQLQSENGILGLGPYPRKGQEDADLINAGKE
TVTLNPGAAVFGSEESFGMIRSGRINLTILGAMQVSGTGDLANWMLPGKVKGFGGAMDLVSNPSATKVVITMEHT
DKKGNAKIVRQCAFPLTGRACVSRIITELGVFDVDFTRGLTLIEIADGVTVDEIKAKTEAPFVISEDLKPMM*
Coding >OphauG2|1165
ATGAGTCCTCTTCGTCTGGCTTGGCACGCGCAGACGCGCACGCTTGGTGCCTTTGCTCGCCATGGCACCGCTTTT
GCACCGCTGCTTTCCAGGCCCTTTTCCGTTTCCTTGCGCCGCGCCGAGATCAACAAGGTCTTGTCATCGGCCGCT
GAAGCAATTCGAGACTTGCAGCCCAACTCAACCCTGCTCTGTGGTGGCTTTGGACTCTGTGGCGTCCCAGACACC
CTTATCAATGAGGTGCTGACCCGCCCCGATATCACAGGACTGACGGCCGTCTCCAACAACGCAGGCACCGACAAC
TCGGGCCTCGGCAAGCTGCTCAAGACGAAGCAAGTCAGCAAAATGATTGCCAGCTACATTGGCGAGAACAAGACG
TTTGAGACCATGTATCTCACAGGAGAGGTGGAGCTGGAACTCACTCCCCAAGGCACTCTGGCTGAGCGATGTGCC
GCCGGCGGCAAAGGCATTCCCGCCTTTTACACTCCTGCTGCCATTGGCACCGTTGTCCAGACCGGTGATTTGTCC
CTGAAAAACAGGGCTGACGGCACTCCAGCAGAGTTGTCGTGTCCCAAGGATGTCAAGGTCTTCAACGGAAAGCCA
TATCTTCTCGAGCATAGCATTGCTGGCGACTACGCCTTTGTCAAAGCCTACCGCGCCGACAGGCTGGGCAACTGT
CAGTTCCGTCTTGCTGCCCACAACTTCAATGGTGCCATGGGTCGCAATGCTGCAACTACCATTGTTGAAGCCGAG
CACATTGTCGAACCCGGAGAGATTGCTCCCGAGGCTGTTCATTTACCTGGCATCTATGTCAAGCGCGTCATCAAG
AGCACCACTGAGAAACAGATTGAAAAGTTCACCTGGGCCAAGCCCGACGACGAGGCCAAGGCAAGCGCCCTCGGC
ACTGGCGATGCTGCCGCCAAGCGCCAACGCATCGTCCAAAGGGCAGCCAAGGAGTTCAAGAATGGCATGTATGCA
AATCTAGGCATTGGCATGCCAATGTTGGCCCCTGGATTTGTTGGTCCTGAAGTCGAGGTTCAGCTGCAATCCGAG
AATGGCATCTTGGGCTTGGGTCCGTATCCGAGAAAGGGTCAAGAAGACGCCGATCTCATCAACGCAGGAAAGGAA
ACCGTGACGCTTAATCCTGGCGCAGCAGTCTTTGGCAGCGAAGAGAGCTTTGGCATGATTCGCAGTGGCAGAATA
AATCTTACCATTCTTGGCGCAATGCAAGTCAGTGGCACTGGTGACTTGGCCAATTGGATGCTACCGGGCAAAGTC
AAGGGCTTTGGTGGTGCCATGGACCTTGTCAGCAATCCTTCTGCTACAAAGGTAGTCATCACCATGGAACACACG
GATAAAAAGGGCAACGCCAAGATTGTTAGGCAGTGTGCTTTCCCTCTGACTGGAAGAGCTTGCGTTTCCAGAATC
ATAACAGAATTGGGGGTATTTGACGTAGACTTTACACGTGGCCTCACTCTTATTGAAATTGCCGACGGAGTTACG
GTGGATGAAATAAAGGCCAAGACGGAAGCACCATTTGTCATTTCCGAAGACCTAAAGCCAATGATGTAG
Transcript >OphauG2|1165
ATGAGTCCTCTTCGTCTGGCTTGGCACGCGCAGACGCGCACGCTTGGTGCCTTTGCTCGCCATGGCACCGCTTTT
GCACCGCTGCTTTCCAGGCCCTTTTCCGTTTCCTTGCGCCGCGCCGAGATCAACAAGGTCTTGTCATCGGCCGCT
GAAGCAATTCGAGACTTGCAGCCCAACTCAACCCTGCTCTGTGGTGGCTTTGGACTCTGTGGCGTCCCAGACACC
CTTATCAATGAGGTGCTGACCCGCCCCGATATCACAGGACTGACGGCCGTCTCCAACAACGCAGGCACCGACAAC
TCGGGCCTCGGCAAGCTGCTCAAGACGAAGCAAGTCAGCAAAATGATTGCCAGCTACATTGGCGAGAACAAGACG
TTTGAGACCATGTATCTCACAGGAGAGGTGGAGCTGGAACTCACTCCCCAAGGCACTCTGGCTGAGCGATGTGCC
GCCGGCGGCAAAGGCATTCCCGCCTTTTACACTCCTGCTGCCATTGGCACCGTTGTCCAGACCGGTGATTTGTCC
CTGAAAAACAGGGCTGACGGCACTCCAGCAGAGTTGTCGTGTCCCAAGGATGTCAAGGTCTTCAACGGAAAGCCA
TATCTTCTCGAGCATAGCATTGCTGGCGACTACGCCTTTGTCAAAGCCTACCGCGCCGACAGGCTGGGCAACTGT
CAGTTCCGTCTTGCTGCCCACAACTTCAATGGTGCCATGGGTCGCAATGCTGCAACTACCATTGTTGAAGCCGAG
CACATTGTCGAACCCGGAGAGATTGCTCCCGAGGCTGTTCATTTACCTGGCATCTATGTCAAGCGCGTCATCAAG
AGCACCACTGAGAAACAGATTGAAAAGTTCACCTGGGCCAAGCCCGACGACGAGGCCAAGGCAAGCGCCCTCGGC
ACTGGCGATGCTGCCGCCAAGCGCCAACGCATCGTCCAAAGGGCAGCCAAGGAGTTCAAGAATGGCATGTATGCA
AATCTAGGCATTGGCATGCCAATGTTGGCCCCTGGATTTGTTGGTCCTGAAGTCGAGGTTCAGCTGCAATCCGAG
AATGGCATCTTGGGCTTGGGTCCGTATCCGAGAAAGGGTCAAGAAGACGCCGATCTCATCAACGCAGGAAAGGAA
ACCGTGACGCTTAATCCTGGCGCAGCAGTCTTTGGCAGCGAAGAGAGCTTTGGCATGATTCGCAGTGGCAGAATA
AATCTTACCATTCTTGGCGCAATGCAAGTCAGTGGCACTGGTGACTTGGCCAATTGGATGCTACCGGGCAAAGTC
AAGGGCTTTGGTGGTGCCATGGACCTTGTCAGCAATCCTTCTGCTACAAAGGTAGTCATCACCATGGAACACACG
GATAAAAAGGGCAACGCCAAGATTGTTAGGCAGTGTGCTTTCCCTCTGACTGGAAGAGCTTGCGTTTCCAGAATC
ATAACAGAATTGGGGGTATTTGACGTAGACTTTACACGTGGCCTCACTCTTATTGAAATTGCCGACGGAGTTACG
GTGGATGAAATAAAGGCCAAGACGGAAGCACCATTTGTCATTTCCGAAGACCTAAAGCCAATGATGTAG
Gene >OphauG2|1165
ATGAGTCCTCTTCGTCTGGCTTGGCACGCGCAGACGCGCACGCTTGGTGCCTTTGCTCGCCATGGCACCGCTTTT
GCACCGCTGCTTTCCAGGCCCTTTTCCGTTTCCTTGCGCCGCGCCGAGATCAACAAGGTCTTGTCATCGGCCGCT
GAAGCAATTCGAGACTTGCAGCCCAACTCAACCCTGCTCTGTGGTGGCTTTGGACTCTGTGGCGTCCCAGACACC
CTTATCAATGAGGTGCTGACCCGCCCCGATATCACAGGACTGACGGCCGTCTCCAACAACGCAGGCACCGACAAC
TCGGGCCTCGGCAAGCTGCTCAAGACGAAGCAAGTCAGCAAAATGATTGCCAGCTACATTGGCGAGAACAAGACG
TTTGAGACCATGTATCTCACAGGAGAGGTGGAGCTGGAACTCACTCCCCAAGGCACTCTGGCTGAGCGATGTGCC
GCCGGCGGCAAAGGCATTCCCGCCTTTTACACTCCTGCTGCCATTGGCACCGTTGTCCAGACCGGTGATTTGTCC
CTGAAAAACAGGGCTGACGGCACTCCAGCAGAGTTGTCGTGTCCCAAGGATGTCAAGGTCTTCAACGGAAAGCCA
TATCTTCTCGAGCATAGCATTGCTGGCGACTACGCCTTTGTCAAAGCCTACCGCGCCGACAGGCTGGGCAACTGT
CAGTTCCGTCTTGCTGCCCACAACTTCAATGGTGCCATGGGTCGCAATGCTGCAACTACCATTGTTGAAGCCGAG
CACATTGTCGAACCCGGAGAGATTGCTCCCGAGGCTGTTCATTTACCTGGCATCTATGTCAAGCGCGTCATCAAG
AGCACCACTGAGAAACAGATTGAAAAGTTCACCTGGGCCAAGCCCGACGACGAGGCCAAGGCAAGCGCCCTCGGC
ACTGGCGATGCTGCCGCCAAGCGCCAACGCATCGTCCAAAGGGCAGCCAAGGAGTTCAAGAATGGCATGTATGCA
AATCTAGGCATTGGCATGCCAATGTTGGCCCCTGGATTTGTTGGTCCTGAAGTCGAGGTTCAGCTGCAATCCGAG
AATGGCATCTTGGGCTTGGGTCCGTATCCGAGAAAGGGTCAAGAAGACGCCGATCTCATCAACGCAGGAAAGGAA
ACCGTGACGCTTAATCCTGGCGCAGCAGTCTTTGGCAGCGAAGAGAGCTTTGGCATGATTCGCAGTGGCAGAATA
AATCTTACCATTCTTGGCGCAATGCAAGTCAGTGGCACTGGTGACTTGGCCAATTGGATGCTACCGGGCAAAGTC
AAGGGCTTTGGTGGTGCCATGGACCTTGTCAGCAATCCTTCTGCTACAAAGGTAGTCATCACCATGGAACACACG
GATAAAAAGGGCAACGCCAAGATTGTTAGGCAGTGTGCTTTCCCTCTGACTGGAAGAGCTTGCGTTTCCAGAATC
ATAACAGAATTGGTCAGTGCCCATGGTTACACCTTGTCTTGTTGCTCTACTGACTGCATCACTAGGGGGTATTTG
ACGTAGACTTTACACGTGGCCTCACTCTTATTGAAATTGCCGACGGAGTTACGGTGGATGAAATAAAGGCCAAGA
CGGAAGCACCATTTGTCATTTCCGAAGACCTAAAGCCAATGATGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail