Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1164
Gene name
LocationContig_133:6611..7520
Strand-
Gene length (bp)909
Transcript length (bp)759
Coding sequence length (bp)759
Protein length (aa) 253

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10252 PP28 Casein kinase substrate phosphoprotein PP28 2.8E-26 134 219

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q13442|HAP28_HUMAN 28 kDa heat- and acid-stable phosphoprotein OS=Homo sapiens GN=PDAP1 PE=1 SV=1 149 205 1.0E-06
sp|Q62785|HAP28_RAT 28 kDa heat- and acid-stable phosphoprotein OS=Rattus norvegicus GN=Pdap1 PE=1 SV=1 149 205 1.0E-06
sp|Q3UHX2|HAP28_MOUSE 28 kDa heat- and acid-stable phosphoprotein OS=Mus musculus GN=Pdap1 PE=1 SV=1 149 205 1.0E-06

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2152
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1164 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2620
Ophiocordyceps camponoti-floridani Ophcf2|03212
Ophiocordyceps camponoti-rufipedis Ophun1|4922
Ophiocordyceps kimflemingae Ophio5|5374
Ophiocordyceps subramaniannii Hirsu2|2631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1164
MAGGSGTSAAGGRRAGKYNKPTRGGGKHYSRSLQPVDSDGNLISIWSANSQHGSEGSQDPDEDESSSDDQDNSGA
GPSSAVITGTTENREDRKALKKARKDAALAKQRAQAVEVGDLPPSDDESDQDGHGMPANPNHSKAARKMAKGDVA
EITEGIGNLKPPASRREREAAEAIAEKERYLKLQAQGKTDEAKADLARLKLIREQREAEFARRQAEKEEKEEKDK
ARKAETEAREAKRREAAAGPKKSNKKK*
Coding >OphauG2|1164
ATGGCTGGCGGCAGTGGCACCTCTGCTGCTGGCGGTCGTCGTGCTGGCAAGTACAACAAACCAACAAGAGGAGGC
GGCAAGCACTATTCTCGAAGCCTCCAGCCCGTCGACTCGGATGGCAATTTGATCAGCATCTGGAGCGCCAATTCT
CAACACGGCTCAGAGGGCTCACAAGATCCAGACGAGGATGAGTCGTCTTCAGACGACCAGGACAACAGCGGTGCT
GGTCCTTCATCGGCCGTCATTACCGGTACCACTGAGAATCGAGAGGATCGCAAGGCTCTTAAAAAAGCCCGCAAG
GACGCTGCTTTGGCTAAGCAGAGAGCACAGGCAGTTGAAGTTGGCGACTTGCCCCCGAGCGATGACGAGAGTGAC
CAAGATGGCCATGGCATGCCGGCGAACCCAAATCACTCCAAAGCAGCGCGGAAAATGGCCAAGGGAGATGTCGCG
GAAATCACGGAGGGCATTGGTAACCTCAAGCCACCAGCGAGCCGTCGCGAGCGAGAGGCAGCAGAGGCCATTGCT
GAGAAGGAGAGATACCTAAAGTTACAAGCACAGGGGAAGACAGACGAAGCCAAAGCCGACTTGGCAAGACTCAAG
CTCATACGAGAGCAGCGTGAGGCTGAATTTGCTAGAAGACAGGCCGAGAAGGAAGAAAAAGAGGAAAAGGACAAG
GCGCGAAAGGCGGAGACGGAAGCCCGGGAAGCCAAACGGCGCGAAGCCGCCGCTGGCCCCAAGAAATCAAACAAG
AAGAAGTGA
Transcript >OphauG2|1164
ATGGCTGGCGGCAGTGGCACCTCTGCTGCTGGCGGTCGTCGTGCTGGCAAGTACAACAAACCAACAAGAGGAGGC
GGCAAGCACTATTCTCGAAGCCTCCAGCCCGTCGACTCGGATGGCAATTTGATCAGCATCTGGAGCGCCAATTCT
CAACACGGCTCAGAGGGCTCACAAGATCCAGACGAGGATGAGTCGTCTTCAGACGACCAGGACAACAGCGGTGCT
GGTCCTTCATCGGCCGTCATTACCGGTACCACTGAGAATCGAGAGGATCGCAAGGCTCTTAAAAAAGCCCGCAAG
GACGCTGCTTTGGCTAAGCAGAGAGCACAGGCAGTTGAAGTTGGCGACTTGCCCCCGAGCGATGACGAGAGTGAC
CAAGATGGCCATGGCATGCCGGCGAACCCAAATCACTCCAAAGCAGCGCGGAAAATGGCCAAGGGAGATGTCGCG
GAAATCACGGAGGGCATTGGTAACCTCAAGCCACCAGCGAGCCGTCGCGAGCGAGAGGCAGCAGAGGCCATTGCT
GAGAAGGAGAGATACCTAAAGTTACAAGCACAGGGGAAGACAGACGAAGCCAAAGCCGACTTGGCAAGACTCAAG
CTCATACGAGAGCAGCGTGAGGCTGAATTTGCTAGAAGACAGGCCGAGAAGGAAGAAAAAGAGGAAAAGGACAAG
GCGCGAAAGGCGGAGACGGAAGCCCGGGAAGCCAAACGGCGCGAAGCCGCCGCTGGCCCCAAGAAATCAAACAAG
AAGAAGTGA
Gene >OphauG2|1164
ATGGCTGGCGGCAGTGGCACCTCTGCTGCTGGCGGTCGTCGTGCTGGCAAGTACAACAAACCAACAAGAGGAGGT
GAGCTGAAATTTGACTACTCATGCTGCTCACGAGTACGCTTTGGCTCATTGTGGCTATTGCGAAATAGGCGGCAA
GCACTATTCTCGAAGCCTCCAGCCCGTCGACTCGGATGGCAATTTGATCAGCATCTGGAGCGCCAATTCTCAACA
CGGCTCAGAGGGCTCACAAGATCCAGACGAGGATGAGTCGTCTTCAGACGACCAGGACAACAGCGGTGCTGGTCC
TTCATCGGCCGTCATTACCGGTACCACTGAGAATCGAGAGGATCGCAAGGCTCTTAAAAAAGCCCGCAAGGACGC
TGCTTTGGCTAAGCAGAGAGCACAGGCAGTTGAAGTTGGCGACTTGCCCCCGAGCGATGACGAGAGTGACCAAGA
TGGCCATGGCATGCCGGCGAACCCAAATCACTCCAAAGCAGCGCGGAAAATGGCCAAGGGAGATGTCGCGGAAAT
CACGGAGGGCATTGGTAACCTCAAGCCACCAGCGAGCCGTCGCGAGCGAGAGGCAGCAGAGGCCATTGCTGAGAA
GGAGAGATACCTAAAGTTACAAGCACAGGGGAAGACAGACGAAGCCAAAGCCGACTTGGCAAGACTCAAGCTCAT
ACGAGAGCAGCGTGAGGCTGAATTTGCTAGAAGACAGGTACGAACTAGTCCGGGCTTACTGACTAGTGTCTCCCT
ATGCATGCCATGAACACTTGACTGACCTATATCATACACAAGGCCGAGAAGGAAGAAAAAGAGGAAAAGGACAAG
GCGCGAAAGGCGGAGACGGAAGCCCGGGAAGCCAAACGGCGCGAAGCCGCCGCTGGCCCCAAGAAATCAAACAAG
AAGAAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail