Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1162
Gene name
LocationContig_133:4186..5230
Strand-
Gene length (bp)1044
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04935 SURF6 Surfeit locus protein 6 1.3E-48 129 318

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P36080|RRP14_YEAST Ribosomal RNA-processing protein 14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP14 PE=1 SV=1 99 340 1.0E-21
sp|Q9VDS6|SURF6_DROME Surfeit locus protein 6 homolog OS=Drosophila melanogaster GN=Surf6 PE=1 SV=1 211 336 1.0E-13
sp|O43082|RR14C_SCHPO Ribosomal RNA-processing protein 14-C OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp14c PE=1 SV=1 100 307 3.0E-12
sp|P70279|SURF6_MOUSE Surfeit locus protein 6 OS=Mus musculus GN=Surf6 PE=1 SV=1 231 322 7.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2438
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1162 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|2621
Ophiocordyceps camponoti-floridani Ophcf2|03211
Ophiocordyceps camponoti-rufipedis Ophun1|4923
Ophiocordyceps kimflemingae Ophio5|173
Ophiocordyceps subramaniannii Hirsu2|3469

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1162
MKPKHMRKGTTGHRQQNEAQGSTDNVAPTNVLATEDAVEHSASSVSESDSLSRTFDTSDSITLRERGVGHVASTN
TSVSSTIPPSVKPKHLKIPVDTTALRARLAAKIEALRAARKADGPDGKPIRTRQELIEARRAKEAQRKAHKKELR
RKAKLEEARKREEELASNSPGVMSPSVELDATTNISFGRVIFDDGSQMSHDLSYVLNQGKKKGPSDPKTALLKVQ
NQKKRLQDLDAEKQADVADKEAWLTARRRFEGDKIRDDEGILKKAVKRKEAIKKKSDKAWKERVQGVEHAQKERQ
KKREENIKKRREEKMMGKAGKRKGGSKMKKKGRPGFEGRLGVMSSKK*
Coding >OphauG2|1162
ATGAAGCCAAAACACATGCGCAAGGGCACAACAGGGCATCGGCAACAGAACGAGGCGCAGGGCTCCACAGATAAT
GTTGCGCCCACAAACGTCTTGGCTACCGAAGACGCTGTTGAACACAGCGCTTCATCGGTTTCTGAGTCCGACTCC
TTATCTCGCACATTTGACACAAGCGATTCTATAACGCTTCGGGAACGCGGTGTCGGACATGTTGCCAGCACCAAT
ACATCAGTGTCATCAACGATACCGCCTTCGGTTAAACCTAAGCACCTCAAGATTCCCGTCGATACTACTGCGCTC
AGAGCTCGATTGGCTGCCAAGATTGAGGCGCTTCGCGCAGCTAGAAAAGCCGACGGCCCCGACGGAAAGCCCATC
AGAACTCGGCAAGAACTTATTGAGGCAAGGCGAGCCAAAGAGGCGCAGCGCAAGGCACATAAGAAGGAACTCAGA
AGAAAAGCCAAGCTTGAAGAGGCGAGAAAACGCGAGGAGGAGCTGGCTTCAAACTCTCCTGGCGTCATGAGCCCT
TCGGTCGAACTTGATGCCACCACCAACATTTCTTTTGGTCGCGTTATTTTCGATGACGGGTCACAAATGTCGCAC
GATCTAAGCTACGTGCTGAACCAGGGCAAAAAAAAGGGCCCCTCCGACCCCAAAACTGCGCTACTCAAGGTGCAG
AACCAGAAGAAGCGGCTACAGGACCTCGATGCGGAGAAGCAGGCCGATGTCGCCGACAAGGAAGCATGGCTTACG
GCTCGACGACGGTTTGAAGGCGACAAGATACGCGATGATGAGGGCATACTCAAAAAAGCCGTCAAGCGCAAAGAG
GCAATCAAGAAGAAAAGTGACAAGGCGTGGAAAGAGCGCGTGCAGGGTGTGGAACACGCACAAAAGGAGCGCCAG
AAGAAACGAGAGGAAAACATCAAAAAGCGACGCGAAGAAAAGATGATGGGCAAGGCTGGAAAGAGGAAGGGAGGA
AGCAAAATGAAGAAGAAAGGGCGGCCTGGCTTCGAGGGCAGGCTAGGCGTAATGAGCAGCAAAAAGTAG
Transcript >OphauG2|1162
ATGAAGCCAAAACACATGCGCAAGGGCACAACAGGGCATCGGCAACAGAACGAGGCGCAGGGCTCCACAGATAAT
GTTGCGCCCACAAACGTCTTGGCTACCGAAGACGCTGTTGAACACAGCGCTTCATCGGTTTCTGAGTCCGACTCC
TTATCTCGCACATTTGACACAAGCGATTCTATAACGCTTCGGGAACGCGGTGTCGGACATGTTGCCAGCACCAAT
ACATCAGTGTCATCAACGATACCGCCTTCGGTTAAACCTAAGCACCTCAAGATTCCCGTCGATACTACTGCGCTC
AGAGCTCGATTGGCTGCCAAGATTGAGGCGCTTCGCGCAGCTAGAAAAGCCGACGGCCCCGACGGAAAGCCCATC
AGAACTCGGCAAGAACTTATTGAGGCAAGGCGAGCCAAAGAGGCGCAGCGCAAGGCACATAAGAAGGAACTCAGA
AGAAAAGCCAAGCTTGAAGAGGCGAGAAAACGCGAGGAGGAGCTGGCTTCAAACTCTCCTGGCGTCATGAGCCCT
TCGGTCGAACTTGATGCCACCACCAACATTTCTTTTGGTCGCGTTATTTTCGATGACGGGTCACAAATGTCGCAC
GATCTAAGCTACGTGCTGAACCAGGGCAAAAAAAAGGGCCCCTCCGACCCCAAAACTGCGCTACTCAAGGTGCAG
AACCAGAAGAAGCGGCTACAGGACCTCGATGCGGAGAAGCAGGCCGATGTCGCCGACAAGGAAGCATGGCTTACG
GCTCGACGACGGTTTGAAGGCGACAAGATACGCGATGATGAGGGCATACTCAAAAAAGCCGTCAAGCGCAAAGAG
GCAATCAAGAAGAAAAGTGACAAGGCGTGGAAAGAGCGCGTGCAGGGTGTGGAACACGCACAAAAGGAGCGCCAG
AAGAAACGAGAGGAAAACATCAAAAAGCGACGCGAAGAAAAGATGATGGGCAAGGCTGGAAAGAGGAAGGGAGGA
AGCAAAATGAAGAAGAAAGGGCGGCCTGGCTTCGAGGGCAGGCTAGGCGTAATGAGCAGCAAAAAGTAG
Gene >OphauG2|1162
ATGAAGCCAAAACACATGCGCAAGGGCACAACAGGGCATCGGCAACAGAACGAGGCGCAGGGCTCCACAGATAAT
GTTGCGCCCACAAACGTCTTGGCTACCGAAGACGCTGTTGAACACAGCGCTTCATCGGTTTCTGAGTCCGACTCC
TTATCTCGCACATTTGACACAAGCGATTCTATAACGCTTCGGGAACGCGGTGTCGGACATGTTGCCAGCACCAAT
ACATCAGTGTCATCAACGATACCGCCTTCGGTTAAACCTAAGCACCTCAAGATTCCCGTCGATACTACTGCGCTC
AGAGCTCGATTGGCTGCCAAGATTGAGGCGCTTCGCGCAGCTAGAAAAGCCGACGGCCCCGACGGAAAGCCCATC
AGAACTCGGCAAGAACTTATTGAGGCAAGGCGAGCCAAAGAGGCGCAGCGCAAGGCACATAAGAAGGAACTCAGA
AGAAAAGCCAAGCTTGAAGAGGCGAGAAAACGCGAGGAGGAGCTGGCTTCAAACTCTCCTGGCGTCATGAGCCCT
TCGGTCGAACTTGATGCCACCACCAACATTTCTTTTGGTCGCGTTATTTTCGATGACGGGTCACAAATGTCGCAC
GATCTAAGCTACGTGCTGAACCAGGGCAAAAAAAAGGGCCCCTCCGACCCCAAAACTGCGCTACTCAAGGTGCAG
AACCAGAAGAAGCGGCTACAGGACCTCGATGCGGAGAAGCAGGCCGATGTCGCCGACAAGGAAGCATGGCTTACG
GCTCGACGACGGTTTGAAGGCGACAAGATACGCGATGATGAGGGCATACTCAAAAAAGCCGTCAAGCGCAAAGAG
GCAATCAAGAAGAAAAGTGACAAGGCGTGGAAAGAGCGCGTGCAGGGTGTGGAACACGCACAAAAGGAGCGCCAG
AAGAAACGAGAGGAAAACATCAAAAAGCGACGCGAAGAAAAGATGATGGGCAAGGCTGGAAAGAGGAAGGGAGGA
AGCAAAATGAAGAAGAAAGGGCGGCCTGGCTTCGAGGGCAGGCTAGGCGTAATGAGCAGCAAAAAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail