Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1159
Gene name
LocationContig_1329:2692..4135
Strand-
Gene length (bp)1443
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09814 HECT_2 HECT-like Ubiquitin-conjugating enzyme (E2)-binding 7.7E-88 9 376

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P47172|YJ9I_YEAST Uncharacterized protein YJR141W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR141W PE=4 SV=1 96 375 2.0E-11
sp|O74751|YHFA_SCHPO Uncharacterized protein C1734.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1734.10c PE=4 SV=1 90 383 2.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 21 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1159
MALLMIYAELLFNIRQVTVAVSLPSPRNATTAATIVDEGRRLCLDHDGQSASLDLPAAVGFDASLGPSQGPLTEL
VWRLGAANALPRAEDTCAEPWSAVHLKTASPVLCKTCRACLVPRHVVASWKDLPSENWAEMMEFWHCHKPVNTQS
ESDHDTLANKGYGANAAMRAQTGVGLVGTSSFAFAESDCCGLLFASSPIEAKVEASALARDEASTTLDLLVFCAK
CGLQVGSHSSRTLAVTLFKWHVMCEATPPGRAPSAPECLAATLLTAMSCSGYAKFTIVPNEAHDKSDTVLFLWVL
NPHVVYTSTAVQGSRAAVKVFYQDISLARGHMLVEPVTSDVQEISLPVESIQTVRQALVFSNKLLPERERRFNDW
RTALLPRWSVET*
Coding >OphauG2|1159
ATGGCCTTGCTCATGATATACGCAGAGCTCCTCTTCAACATTAGACAGGTGACTGTTGCAGTCTCGCTTCCCTCT
CCCCGCAACGCAACGACGGCCGCAACTATTGTCGACGAGGGCCGCCGTCTCTGCCTTGACCACGATGGCCAGTCA
GCCTCTCTTGACCTTCCCGCCGCCGTTGGCTTTGATGCCTCTCTGGGCCCGTCCCAGGGCCCTCTGACAGAGCTA
GTTTGGAGACTCGGCGCTGCCAATGCTTTGCCCCGTGCCGAGGACACTTGTGCCGAACCATGGAGCGCCGTGCAT
CTCAAGACGGCATCGCCAGTCTTATGCAAGACGTGTCGAGCTTGTCTTGTGCCACGCCATGTCGTGGCATCGTGG
AAGGACCTTCCCAGTGAAAACTGGGCCGAGATGATGGAGTTTTGGCACTGCCACAAGCCCGTGAATACTCAGAGC
GAGTCGGACCATGACACCCTCGCCAACAAGGGCTATGGCGCCAACGCTGCCATGAGGGCGCAGACGGGCGTTGGC
TTGGTTGGCACAAGCTCCTTTGCCTTTGCCGAGTCGGACTGCTGTGGCCTGCTGTTTGCAAGCTCGCCAATAGAG
GCAAAGGTCGAGGCCAGTGCCTTGGCACGAGATGAGGCCAGCACGACGTTGGATCTGCTCGTATTCTGTGCCAAG
TGTGGCTTGCAAGTCGGCTCTCACAGCTCGCGTACGCTGGCCGTGACGCTCTTCAAGTGGCACGTCATGTGCGAA
GCCACGCCGCCGGGCAGAGCACCCAGCGCACCCGAATGCCTTGCTGCGACTCTGCTCACAGCAATGTCTTGCTCG
GGCTATGCCAAATTCACCATTGTGCCTAATGAGGCCCATGACAAGTCTGACACTGTCTTATTTCTCTGGGTCCTG
AATCCCCACGTCGTCTACACGTCTACGGCGGTCCAAGGCTCAAGAGCCGCGGTCAAAGTCTTTTACCAAGACATT
AGCTTGGCTCGAGGGCACATGTTGGTGGAGCCCGTGACTTCGGACGTGCAGGAGATCAGTCTGCCGGTGGAATCG
ATACAGACGGTGCGGCAAGCGCTCGTCTTTAGCAACAAGCTACTGCCGGAGCGCGAGCGACGATTTAATGATTGG
CGTACGGCCTTGTTGCCCCGATGGAGCGTCGAGACTTGA
Transcript >OphauG2|1159
ATGGCCTTGCTCATGATATACGCAGAGCTCCTCTTCAACATTAGACAGGTGACTGTTGCAGTCTCGCTTCCCTCT
CCCCGCAACGCAACGACGGCCGCAACTATTGTCGACGAGGGCCGCCGTCTCTGCCTTGACCACGATGGCCAGTCA
GCCTCTCTTGACCTTCCCGCCGCCGTTGGCTTTGATGCCTCTCTGGGCCCGTCCCAGGGCCCTCTGACAGAGCTA
GTTTGGAGACTCGGCGCTGCCAATGCTTTGCCCCGTGCCGAGGACACTTGTGCCGAACCATGGAGCGCCGTGCAT
CTCAAGACGGCATCGCCAGTCTTATGCAAGACGTGTCGAGCTTGTCTTGTGCCACGCCATGTCGTGGCATCGTGG
AAGGACCTTCCCAGTGAAAACTGGGCCGAGATGATGGAGTTTTGGCACTGCCACAAGCCCGTGAATACTCAGAGC
GAGTCGGACCATGACACCCTCGCCAACAAGGGCTATGGCGCCAACGCTGCCATGAGGGCGCAGACGGGCGTTGGC
TTGGTTGGCACAAGCTCCTTTGCCTTTGCCGAGTCGGACTGCTGTGGCCTGCTGTTTGCAAGCTCGCCAATAGAG
GCAAAGGTCGAGGCCAGTGCCTTGGCACGAGATGAGGCCAGCACGACGTTGGATCTGCTCGTATTCTGTGCCAAG
TGTGGCTTGCAAGTCGGCTCTCACAGCTCGCGTACGCTGGCCGTGACGCTCTTCAAGTGGCACGTCATGTGCGAA
GCCACGCCGCCGGGCAGAGCACCCAGCGCACCCGAATGCCTTGCTGCGACTCTGCTCACAGCAATGTCTTGCTCG
GGCTATGCCAAATTCACCATTGTGCCTAATGAGGCCCATGACAAGTCTGACACTGTCTTATTTCTCTGGGTCCTG
AATCCCCACGTCGTCTACACGTCTACGGCGGTCCAAGGCTCAAGAGCCGCGGTCAAAGTCTTTTACCAAGACATT
AGCTTGGCTCGAGGGCACATGTTGGTGGAGCCCGTGACTTCGGACGTGCAGGAGATCAGTCTGCCGGTGGAATCG
ATACAGACGGTGCGGCAAGCGCTCGTCTTTAGCAACAAGCTACTGCCGGAGCGCGAGCGACGATTTAATGATTGG
CGTACGGCCTTGTTGCCCCGATGGAGCGTCGAGACTTGA
Gene >OphauG2|1159
ATGGCCTTGCTCATGATATACGCAGAGCTCCTCTTCAACATTAGACAGGTGACTGTTGCAGTCTCGCTTCCCTCT
CCCCGCAACGCAACGACGGCCGCAACTATTGTCGACGAGGGCCGCCGTCTCTGCCTTGACCACGATGGCCAGTCA
GCCTCTCTTGACCTTCCCGCCGCCGTTGGCTTTGATGCCTCTCTGGGCCCGTCCCAGGGCCCTCTGACAGAGCTA
GTTTGGAGACTCGGCGCTGCCAATGCTTTGCCCCGTGCCGAGGACACTTGTGCCGAACCATGGAGCGCCGTGCAT
CTCAAGACGGCATCGCCAGTCTTATGCAAGACGTGTCGAGCTTGTCTTGTGCCACGCCATGTCGTGGCATCGTGG
AAGGACCTTCCCAGTGAAAACTGGGCCGAGATGATGGAGTTTTGGCACTGCCACAAGCCCGTGAATACTCAGAGC
GAGTCGGACCATGACACCCTCGCCAACAAGGGCTATGGCGCCAACGCTGCCATGAGGGCGCAGACGGGCGTTGGC
TTGGTTGGCACAAGCTCCTTTGCCTTTGCCGAGTCGGACTGCTGTGGCCTGCTGGTGAGTCTTGTTGAGGCACGG
CTCGTTGAAACCCGGGGACCAAGAAGGTGGCCGAGTCTGCAAATGCAAATGATCTTTCCACCGATACAAGTCCCC
AAGAGCAACTCGAGCCGCTTGAAGCGTGCTCCCGCATGAACCCTTCTCTTGCCAGAACGGGATCATTGGAAGCCT
CGCAACCATGGAACCAGTGTCCAGAGCTGTGGACCCTGGTCAAACGACAAGCAAGGCACACGTGTGCTGCATGCA
TTGTTGCTTTTGATGTGTGCTGACGGATTGTAGTTTGCAAGCTCGCCAATAGAGGCAAAGGTCGAGGCCAGTGCC
TTGGCACGAGATGAGGCCAGCACGACGTTGGATCTGCTCGTATTCTGTGCCAAGTGTGGCTTGCAAGTCGGCTCT
CACAGCTCGCGTACGCTGGCCGTGACGCTCTTCAAGTGGCACGTCATGTGCGAAGCCACGCCGCCGGGCAGAGCA
CCCAGCGCACCCGAATGCCTTGCTGCGACTCTGCTCACAGCAATGTCTTGCTCGGGCTATGCCAAATTCACCATT
GTGCCTAATGAGGCCCATGACAAGTCTGACACTGTCTTATTTCTCTGGGTCCTGAATCCCCACGTCGTCTACACG
TCTACGGCGGTCCAAGGCTCAAGAGCCGCGGTCAAAGTCTTTTACCAAGACATTAGCTTGGCTCGAGGGCACATG
TTGGTGGAGCCCGTGACTTCGGACGTGCAGGAGATCAGTCTGCCGGTGGAATCGATACAGACGGTGCGGCAAGCG
CTCGTCTTTAGCAACAAGCTACTGCCGGAGCGCGAGCGACGATTTAATGATTGGCGTACGGCCTTGTTGCCCCGA
TGGAGCGTCGAGACTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail