Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1157
Gene name
LocationContig_1328:1125..3926
Strand+
Gene length (bp)2801
Transcript length (bp)2658
Coding sequence length (bp)2658
Protein length (aa) 886

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12511 DUF3716 Protein of unknown function (DUF3716) 3.1E-09 277 324

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2296
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1157 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3802
Ophiocordyceps camponoti-floridani Ophcf2|01707
Ophiocordyceps camponoti-rufipedis Ophun1|198
Ophiocordyceps kimflemingae Ophio5|4297
Ophiocordyceps subramaniannii Hirsu2|3042

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1157
MEPDKVWEALPPDEHRSVWNETEHNFWKNFETEQEAQVAKAENEFQKSTSDTRFLIASMTGKRSQLVERREWLAK
ELSSIDREIACLNQACDEKCATLALQEREFRRSEQERLENRDKIRQKMQKFFKLKRKELHDTISTPRLSQTDLVR
RASSDRDQVVVSSSAQPSPTLIQPRRTPLPNKDSRPLAVHQLVSTLPAPLLAKDGQTPDTIVNVTDADGNVIGPV
RRIEPWNQWVREILHKPIKRSVKIRRGRKFNQDHLASIYDRSEGKGVKWLSCMIQATGDVLPQRCHSCDKNQGAF
DDCIVLGGPLFQKCGNCEWNRQGCHRPLMSRSSNAGTPQREQPVKSGDEHEAAPDETMAASKAEGPSIVALDGLV
SSAGRRDAGQHASPGFTPANGFTPANSRPCRPPSQDGSTPTANSVDASPRHTPSENGEFLGEITRENLVLQHDGN
VYTYPEIVEGVPVAKIDQTHPYWELGWPCIKSVIEPQLASWREKNVLAQEAKARGEGGSSKFQTGRQVNRGIRIL
EFLDTGEISPYQLVAKKFMNTGKGAIISYDTLFRLCETLSELAKFNLDVTPVEWLRHRLHEIKIEKGSSFNVSRT
VHDFYHDPKLSALRSKNGFKNIGRPSGPKYALSNNGTPQSSLRKRKSINSQMDTPRGSPTILHSPFAVQGSDGYS
QEHSLETCLAPGDETRREPPLKRSRPLSPPSTREQDEAFGQYADFSDIDSCSGAAVAWEDWRLYQVKTRLFTSST
SVTQYWNWKERERILEHQVLKETDPVSWGLYRDPIDFCVRLDDVDEVRWNVDALQLHLTMTPMEKKTSKLDGRPR
GDVLVAFKRERTIRRLLEFFRSKKIRLLEVSPEEMDENWGRIKSEKLPDNDDDASEELKE*
Coding >OphauG2|1157
ATGGAACCCGACAAGGTTTGGGAGGCGCTTCCCCCAGACGAGCACCGCTCCGTCTGGAACGAGACGGAGCACAAC
TTTTGGAAAAACTTCGAAACTGAGCAAGAAGCTCAAGTGGCCAAGGCAGAAAACGAGTTTCAAAAATCCACCTCT
GACACGCGGTTCCTCATTGCTTCAATGACGGGCAAGCGCTCCCAGCTTGTCGAGAGACGCGAGTGGCTTGCCAAG
GAGCTATCAAGCATCGACCGAGAAATCGCCTGCCTCAACCAGGCCTGCGATGAAAAGTGCGCCACCCTGGCCCTG
CAGGAAAGAGAGTTTCGCCGCAGCGAGCAGGAAAGACTGGAAAACCGAGACAAGATTCGTCAAAAAATGCAAAAG
TTTTTCAAGCTTAAACGCAAAGAGCTCCATGACACCATCAGCACTCCCAGACTGAGCCAGACTGACCTTGTGCGC
CGAGCCTCGTCGGACCGCGACCAAGTCGTAGTCTCAAGCTCTGCTCAGCCATCGCCAACTCTAATCCAGCCGCGC
CGAACCCCTCTCCCCAACAAAGACTCACGGCCCTTGGCTGTCCACCAGCTGGTCTCAACACTGCCTGCTCCACTA
CTGGCCAAAGACGGCCAGACGCCTGACACCATTGTCAACGTGACGGACGCTGACGGCAATGTCATTGGGCCCGTC
CGGCGCATCGAGCCGTGGAACCAATGGGTCCGAGAGATTCTGCACAAGCCCATTAAGCGCAGTGTCAAGATTCGA
CGCGGCAGGAAATTCAATCAGGACCATCTCGCCTCGATATACGATCGCTCCGAAGGCAAGGGCGTCAAATGGCTG
TCGTGCATGATTCAGGCCACGGGCGACGTGCTGCCTCAGCGATGCCACTCTTGCGACAAGAATCAAGGCGCCTTT
GACGACTGCATCGTTCTTGGAGGTCCGCTATTCCAAAAATGCGGCAATTGCGAATGGAACCGACAGGGCTGCCAC
CGACCCCTGATGAGCCGATCTAGCAATGCTGGCACGCCCCAGAGGGAACAGCCTGTCAAGAGCGGAGACGAGCAC
GAGGCGGCGCCAGACGAGACCATGGCTGCCTCCAAGGCCGAGGGGCCGTCGATTGTGGCCTTGGATGGCCTAGTT
TCGTCGGCTGGGCGCCGCGACGCCGGCCAGCACGCTAGCCCGGGCTTCACGCCCGCCAATGGATTTACGCCTGCC
AATTCCCGCCCATGCAGGCCTCCCTCTCAAGACGGATCGACACCCACGGCCAACTCCGTCGACGCTTCTCCACGA
CACACCCCCTCGGAAAACGGCGAATTTCTTGGCGAGATTACCCGCGAGAACCTGGTGCTGCAACACGACGGAAAT
GTCTATACCTATCCCGAAATCGTCGAGGGCGTTCCCGTCGCCAAAATTGACCAGACACACCCTTACTGGGAACTT
GGCTGGCCCTGCATCAAATCCGTCATTGAGCCACAGCTAGCCTCGTGGCGCGAAAAGAACGTGCTGGCCCAAGAA
GCCAAAGCCCGAGGCGAGGGAGGCTCCTCCAAGTTTCAGACGGGACGCCAAGTAAATCGCGGAATCCGCATCTTG
GAGTTTCTTGACACGGGCGAAATCAGCCCCTATCAGCTCGTTGCCAAGAAATTCATGAATACCGGCAAGGGCGCC
ATCATTTCCTACGATACCTTGTTCCGCTTGTGCGAAACCCTGTCCGAGTTGGCAAAGTTCAATCTCGACGTGACC
CCTGTCGAATGGCTCAGACATCGCTTGCACGAAATCAAAATAGAAAAAGGCTCCAGTTTTAACGTGTCTCGAACT
GTCCATGACTTTTACCACGATCCCAAGCTATCGGCCCTTCGCTCCAAGAATGGCTTCAAGAATATTGGTCGGCCC
TCAGGCCCCAAGTATGCCCTCAGCAATAATGGCACGCCTCAGAGCTCGCTTCGAAAGCGCAAGAGCATCAATTCA
CAGATGGATACCCCACGCGGCAGTCCCACCATTCTACATTCGCCCTTTGCAGTCCAGGGGTCCGACGGATATTCG
CAGGAACACTCACTCGAGACATGCCTGGCTCCTGGCGATGAGACACGCCGAGAGCCGCCACTGAAGCGTTCACGG
CCTCTGTCACCGCCATCCACAAGGGAACAAGACGAAGCCTTTGGCCAGTATGCAGACTTTTCCGATATCGACTCT
TGCAGTGGCGCAGCCGTGGCCTGGGAAGACTGGCGTCTCTACCAGGTTAAAACAAGACTCTTTACAAGCTCCACC
AGCGTCACCCAGTACTGGAATTGGAAAGAGCGCGAGCGCATCCTCGAGCACCAGGTTCTCAAGGAGACGGATCCA
GTTAGCTGGGGCTTGTACCGAGATCCCATTGACTTTTGCGTTCGGCTCGACGACGTGGATGAGGTGAGGTGGAAC
GTGGATGCACTACAGCTGCATCTAACCATGACCCCGATGGAAAAAAAGACGTCCAAGCTCGACGGCCGACCTCGC
GGAGATGTCTTGGTTGCTTTCAAACGAGAGCGTACCATACGACGGCTGCTTGAATTTTTTCGTAGCAAGAAGATT
AGATTGCTTGAAGTTTCACCTGAGGAAATGGATGAGAATTGGGGCAGAATCAAATCTGAAAAGCTTCCCGATAAT
GATGACGACGCGAGTGAGGAGCTCAAGGAATAG
Transcript >OphauG2|1157
ATGGAACCCGACAAGGTTTGGGAGGCGCTTCCCCCAGACGAGCACCGCTCCGTCTGGAACGAGACGGAGCACAAC
TTTTGGAAAAACTTCGAAACTGAGCAAGAAGCTCAAGTGGCCAAGGCAGAAAACGAGTTTCAAAAATCCACCTCT
GACACGCGGTTCCTCATTGCTTCAATGACGGGCAAGCGCTCCCAGCTTGTCGAGAGACGCGAGTGGCTTGCCAAG
GAGCTATCAAGCATCGACCGAGAAATCGCCTGCCTCAACCAGGCCTGCGATGAAAAGTGCGCCACCCTGGCCCTG
CAGGAAAGAGAGTTTCGCCGCAGCGAGCAGGAAAGACTGGAAAACCGAGACAAGATTCGTCAAAAAATGCAAAAG
TTTTTCAAGCTTAAACGCAAAGAGCTCCATGACACCATCAGCACTCCCAGACTGAGCCAGACTGACCTTGTGCGC
CGAGCCTCGTCGGACCGCGACCAAGTCGTAGTCTCAAGCTCTGCTCAGCCATCGCCAACTCTAATCCAGCCGCGC
CGAACCCCTCTCCCCAACAAAGACTCACGGCCCTTGGCTGTCCACCAGCTGGTCTCAACACTGCCTGCTCCACTA
CTGGCCAAAGACGGCCAGACGCCTGACACCATTGTCAACGTGACGGACGCTGACGGCAATGTCATTGGGCCCGTC
CGGCGCATCGAGCCGTGGAACCAATGGGTCCGAGAGATTCTGCACAAGCCCATTAAGCGCAGTGTCAAGATTCGA
CGCGGCAGGAAATTCAATCAGGACCATCTCGCCTCGATATACGATCGCTCCGAAGGCAAGGGCGTCAAATGGCTG
TCGTGCATGATTCAGGCCACGGGCGACGTGCTGCCTCAGCGATGCCACTCTTGCGACAAGAATCAAGGCGCCTTT
GACGACTGCATCGTTCTTGGAGGTCCGCTATTCCAAAAATGCGGCAATTGCGAATGGAACCGACAGGGCTGCCAC
CGACCCCTGATGAGCCGATCTAGCAATGCTGGCACGCCCCAGAGGGAACAGCCTGTCAAGAGCGGAGACGAGCAC
GAGGCGGCGCCAGACGAGACCATGGCTGCCTCCAAGGCCGAGGGGCCGTCGATTGTGGCCTTGGATGGCCTAGTT
TCGTCGGCTGGGCGCCGCGACGCCGGCCAGCACGCTAGCCCGGGCTTCACGCCCGCCAATGGATTTACGCCTGCC
AATTCCCGCCCATGCAGGCCTCCCTCTCAAGACGGATCGACACCCACGGCCAACTCCGTCGACGCTTCTCCACGA
CACACCCCCTCGGAAAACGGCGAATTTCTTGGCGAGATTACCCGCGAGAACCTGGTGCTGCAACACGACGGAAAT
GTCTATACCTATCCCGAAATCGTCGAGGGCGTTCCCGTCGCCAAAATTGACCAGACACACCCTTACTGGGAACTT
GGCTGGCCCTGCATCAAATCCGTCATTGAGCCACAGCTAGCCTCGTGGCGCGAAAAGAACGTGCTGGCCCAAGAA
GCCAAAGCCCGAGGCGAGGGAGGCTCCTCCAAGTTTCAGACGGGACGCCAAGTAAATCGCGGAATCCGCATCTTG
GAGTTTCTTGACACGGGCGAAATCAGCCCCTATCAGCTCGTTGCCAAGAAATTCATGAATACCGGCAAGGGCGCC
ATCATTTCCTACGATACCTTGTTCCGCTTGTGCGAAACCCTGTCCGAGTTGGCAAAGTTCAATCTCGACGTGACC
CCTGTCGAATGGCTCAGACATCGCTTGCACGAAATCAAAATAGAAAAAGGCTCCAGTTTTAACGTGTCTCGAACT
GTCCATGACTTTTACCACGATCCCAAGCTATCGGCCCTTCGCTCCAAGAATGGCTTCAAGAATATTGGTCGGCCC
TCAGGCCCCAAGTATGCCCTCAGCAATAATGGCACGCCTCAGAGCTCGCTTCGAAAGCGCAAGAGCATCAATTCA
CAGATGGATACCCCACGCGGCAGTCCCACCATTCTACATTCGCCCTTTGCAGTCCAGGGGTCCGACGGATATTCG
CAGGAACACTCACTCGAGACATGCCTGGCTCCTGGCGATGAGACACGCCGAGAGCCGCCACTGAAGCGTTCACGG
CCTCTGTCACCGCCATCCACAAGGGAACAAGACGAAGCCTTTGGCCAGTATGCAGACTTTTCCGATATCGACTCT
TGCAGTGGCGCAGCCGTGGCCTGGGAAGACTGGCGTCTCTACCAGGTTAAAACAAGACTCTTTACAAGCTCCACC
AGCGTCACCCAGTACTGGAATTGGAAAGAGCGCGAGCGCATCCTCGAGCACCAGGTTCTCAAGGAGACGGATCCA
GTTAGCTGGGGCTTGTACCGAGATCCCATTGACTTTTGCGTTCGGCTCGACGACGTGGATGAGGTGAGGTGGAAC
GTGGATGCACTACAGCTGCATCTAACCATGACCCCGATGGAAAAAAAGACGTCCAAGCTCGACGGCCGACCTCGC
GGAGATGTCTTGGTTGCTTTCAAACGAGAGCGTACCATACGACGGCTGCTTGAATTTTTTCGTAGCAAGAAGATT
AGATTGCTTGAAGTTTCACCTGAGGAAATGGATGAGAATTGGGGCAGAATCAAATCTGAAAAGCTTCCCGATAAT
GATGACGACGCGAGTGAGGAGCTCAAGGAATAG
Gene >OphauG2|1157
ATGGAACCCGACAAGGTTTGGGAGGCGCTTCCCCCAGACGAGCACCGCTCCGTCTGGAACGAGACGGAGCACAAC
TTTTGGAAAAACTTCGAAACTGAGCAAGAAGCTCAAGTGGCCAAGGCAGAAAACGAGTTTCAAAAATCCACCTCT
GACACGCGGTTCCTCATTGCTTCAATGACGGGCAAGCGCTCCCAGCTTGTCGAGAGACGCGAGTGGCTTGCCAAG
GAGCTATCAAGCATCGACCGAGAAATCGCCTGCCTCAACCAGGCCTGCGATGAAAAGTGCGCCACCCTGGCCCTG
CAGGAAAGAGAGTTTCGCCGCAGCGAGCAGGAAAGACTGGAAAACCGAGACAAGATTCGTCAAAAAATGCAAAAG
TTTTTCAAGCTTAAACGCAAAGAGCTCCATGACACCATCAGCACTCCCAGACTGAGCCAGACTGACCTTGTGCGC
CGAGCCTCGTCGGACCGCGACCAAGTCGTAGTCTCAAGCTCTGCTCAGCCATCGCCAACTCTAATCCAGCCGCGC
CGAACCCCTCTCCCCAACAAAGACTCACGGCCCTTGGCTGTCCACCAGCTGGTCTCAACACTGCCTGCTCCACTA
CTGGCCAAAGACGGCCAGACGCCTGACACCATTGTCAACGTGACGGACGCTGACGGCAATGTCATTGGGCCCGTC
CGGCGCATCGAGCCGTGGAACCAATGGGTCCGAGAGATTCTGCACAAGCCCATTAAGCGCAGTGTCAAGATTCGA
CGCGGCAGGAAATTCAATCAGGACCATCTCGCCTCGATATACGATCGCTCCGAAGGCAAGGGCGTCAAATGGCTG
TCGTGCATGATTCAGGCCACGGGCGACGTGCTGCCTCAGCGATGCCACTCTTGCGACAAGAATCAAGGCGCCTTT
GACGACTGCATCGTTCTTGGAGGTCCGCTATTCCAAAAATGCGGCAATTGCGAATGGAACCGACAGGGCTGCCAC
CGACCCCTGATGAGCCGATCTAGCAATGCTGGCACGCCCCAGAGGGAACAGCCTGTCAAGAGCGGAGACGAGCAC
GAGGCGGCGCCAGACGAGACCATGGCTGCCTCCAAGGCCGAGGGGCCGTCGATTGTGGCCTTGGATGGCCTAGTT
TCGTCGGCTGGGCGCCGCGACGCCGGCCAGCACGCTAGCCCGGGCTTCACGCCCGCCAATGGATTTACGCCTGCC
AATTCCCGCCCATGCAGGCCTCCCTCTCAAGACGGATCGACACCCACGGCCAACTCCGTCGACGCTTCTCCACGA
CACACCCCCTCGGAAAACGGCGAATTTCTTGGCGAGATTACCCGCGAGAACCTGGTGCTGCAACACGACGGAAAT
GTCTATACCTATCCCGAAATCGTCGAGGGCGTTCCCGTCGCCAAAATTGACCAGACACACCCTTACTGGGAACTT
GGCTGGCCCTGCATCAAATCCGTCATTGAGCCACAGCTAGCCTCGTGGCGCGAAAAGAACGTGCTGGCCCAAGAA
GCCAAAGCCCGAGGCGAGGGAGGCTCCTCCAAGTTTCAGACGGGACGCCAAGTAAATCGCGGAATCCGCATCTTG
GAGTTTCTTGACACGGGCGAAATCAGCCCCTATCAGCTCGTTGCCAAGAAATTCATGAATACCGGCAAGGGCGCC
ATCATTTCCTACGATACCTTGTTCCGCTTGTGCGAAACCCTGTCCGAGTTGGCAAAGTTCAATCTCGACGTGACC
CCTGTCGAATGGCTCAGACATCGCTTGCACGAAATCAAAATAGAAAAAGGCTCCAGTTTTAACGTGTCTCGAACT
GTCCATGACTTTTACCACGATCCCAAGCTATCGGCCCTTCGCTCCAAGAATGGCTTCAAGAATATTGGTCGGCCC
TCAGGCCCCAAGTATGCCCTCAGCAATAATGGCACGCCTCAGAGCTCGCTTCGAAAGCGCAAGAGCATCAATTCA
CAGATGGATACCCCACGCGGCAGTCCCACCATTCTACATTCGCCCTTTGCAGTCCAGGGGTCCGACGGATATTCG
CAGGAACACTCACTCGAGACATGCCTGGCTCCTGGCGATGAGACACGCCGAGAGCCGCCACTGAAGCGTTCACGG
CCTCTGTCACCGCCATCCACAAGGGAACAAGACGAAGCCTTTGGCCAGTATGCAGACTTTTCCGATATCGACTCT
TGCAGTGGCGCAGCCGTGGCCTGGGAAGACTGGCGTCTCTACCAGGTTAAAACAAGACTCTTTACAAGCTCCACC
AGCGTCACCCAGTACTGGAATTGGAAAGAGCGCGAGCGCATCCTCGAGCACCAGGTTCTCAAGGAGACGGATCCA
GTTAGCTGGGGCTTGTACCGAGATCCCATTGACTTTTGCGTTCGGCTCGACGACGTGGATGAGGTGAGGTGGAAC
GTGGATGCACTACAGCTGCATCTAACCATGACCCCGATGGAAAAAAAGACGTCCAAGCTCGACGGCCGACCTCGC
GGAGATGTCTTGGTTGCTTTCAAACGAGAGCGTACCATACGACGGCTGCTTGAATTTTTTCGTAGCAAGAAGATT
AGATTGCTTGAAGTTTCACCGTGAGTCTTTTCATTTTCTTTTCCCTCTTTTTTCTTTTCTTTTTTTTTTAAAAAA
AAAAATCTACTTGTCGGCCAGCCTCATCATACTCTTGTTTATTCTTTCATGGCGAGCAATCAAAATGCGTGGCTA
ACGTTGGACGTAGTGAGGAAATGGATGAGAATTGGGGCAGAATCAAATCTGAAAAGCTTCCCGATAATGATGACG
ACGCGAGTGAGGAGCTCAAGGAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail