Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1149
Gene name
LocationContig_1322:455..1479
Strand+
Gene length (bp)1024
Transcript length (bp)924
Coding sequence length (bp)924
Protein length (aa) 308

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01016 Ribosomal_L27 Ribosomal L27 protein 5.5E-24 36 121

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BIE4|RM02_DEBHA 54S ribosomal protein L2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPL2 PE=3 SV=1 30 142 6.0E-21
sp|Q6C9C4|RM02_YARLI 54S ribosomal protein L2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPL2 PE=3 SV=1 33 142 7.0E-21
sp|P12687|RM02_YEAST 54S ribosomal protein L2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP7 PE=1 SV=1 26 169 4.0E-20
sp|Q6FS31|RM02_CANGA 54S ribosomal protein L2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPL2 PE=3 SV=1 29 145 2.0E-19
sp|Q75ET6|RM02_ASHGO 54S ribosomal protein L2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL2 PE=3 SV=1 14 142 4.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6BIE4|RM02_DEBHA 54S ribosomal protein L2, mitochondrial OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MRPL2 PE=3 SV=1 30 142 6.0E-21
sp|Q6C9C4|RM02_YARLI 54S ribosomal protein L2, mitochondrial OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=MRPL2 PE=3 SV=1 33 142 7.0E-21
sp|P12687|RM02_YEAST 54S ribosomal protein L2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MRP7 PE=1 SV=1 26 169 4.0E-20
sp|Q6FS31|RM02_CANGA 54S ribosomal protein L2, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MRPL2 PE=3 SV=1 29 145 2.0E-19
sp|Q75ET6|RM02_ASHGO 54S ribosomal protein L2, mitochondrial OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRPL2 PE=3 SV=1 14 142 4.0E-19
sp|P48535|RM02_KLULA 54S ribosomal protein L2, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MRPL2 PE=3 SV=2 29 144 4.0E-18
sp|Q9HDV5|RM02_SCHPO 54S ribosomal protein L27, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mrp7 PE=3 SV=1 36 141 1.0E-17
sp|P0CQ48|RM27_CRYNJ 54S ribosomal protein L27, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RPL27 PE=3 SV=1 4 140 3.0E-17
sp|P0CQ49|RM27_CRYNB 54S ribosomal protein L27, mitochondrial OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RPL27 PE=3 SV=1 4 140 3.0E-17
sp|B1M699|RL27_METRJ 50S ribosomal protein L27 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpmA PE=3 SV=1 39 122 2.0E-13
sp|A7IH94|RL27_XANP2 50S ribosomal protein L27 OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=rpmA PE=3 SV=1 39 121 2.0E-12
sp|B9JUI3|RL27_AGRVS 50S ribosomal protein L27 OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=rpmA PE=3 SV=1 39 106 4.0E-12
sp|A9VYM7|RL27_METEP 50S ribosomal protein L27 OS=Methylobacterium extorquens (strain PA1) GN=rpmA PE=3 SV=1 39 106 6.0E-12
sp|B7KSH3|RL27_METC4 50S ribosomal protein L27 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpmA PE=3 SV=1 39 106 6.0E-12
sp|B1ZL17|RL27_METPB 50S ribosomal protein L27 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpmA PE=3 SV=1 39 106 6.0E-12
sp|A0RR38|RL27_CAMFF 50S ribosomal protein L27 OS=Campylobacter fetus subsp. fetus (strain 82-40) GN=rpmA PE=3 SV=1 39 112 6.0E-12
sp|Q13DL3|RL27_RHOPS 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpmA PE=3 SV=1 39 106 1.0E-11
sp|Q24SN8|RL27_DESHY 50S ribosomal protein L27 OS=Desulfitobacterium hafniense (strain Y51) GN=rpmA PE=3 SV=1 53 108 3.0E-11
sp|B8FUS1|RL27_DESHD 50S ribosomal protein L27 OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=rpmA PE=3 SV=1 53 108 3.0E-11
sp|Q30QN9|RL27_SULDN 50S ribosomal protein L27 OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=rpmA PE=3 SV=1 54 112 4.0E-11
sp|A9KEJ8|RL27_COXBN 50S ribosomal protein L27 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|Q6G507|RL27_BARHE 50S ribosomal protein L27 OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|A9IM57|RL27_BART1 50S ribosomal protein L27 OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|Q83ED9|RL27_COXBU 50S ribosomal protein L27 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|A9NBL4|RL27_COXBR 50S ribosomal protein L27 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|B6J1S9|RL27_COXB2 50S ribosomal protein L27 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|B6J9K3|RL27_COXB1 50S ribosomal protein L27 OS=Coxiella burnetii (strain CbuK_Q154) GN=rpmA PE=3 SV=1 39 121 4.0E-11
sp|A1KAC9|RL27_AZOSB 50S ribosomal protein L27 OS=Azoarcus sp. (strain BH72) GN=rpmA PE=3 SV=1 39 106 6.0E-11
sp|B5ZUD9|RL27_RHILW 50S ribosomal protein L27 OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=rpmA PE=3 SV=1 39 106 6.0E-11
sp|Q1MA80|RL27_RHIL3 50S ribosomal protein L27 OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=rpmA PE=3 SV=1 39 106 6.0E-11
sp|A8HRT6|RL27_AZOC5 50S ribosomal protein L27 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpmA PE=3 SV=1 39 106 6.0E-11
sp|Q2K2Y0|RL27_RHIEC 50S ribosomal protein L27 OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=rpmA PE=3 SV=1 39 106 7.0E-11
sp|B3PRY9|RL27_RHIE6 50S ribosomal protein L27 OS=Rhizobium etli (strain CIAT 652) GN=rpmA PE=3 SV=1 39 106 7.0E-11
sp|B9JEQ8|RL27_AGRRK 50S ribosomal protein L27 OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=rpmA PE=3 SV=1 39 106 8.0E-11
sp|A8EZV2|RL27_RICCK 50S ribosomal protein L27 OS=Rickettsia canadensis (strain McKiel) GN=rpmA PE=3 SV=1 37 106 8.0E-11
sp|Q21D07|RL27_RHOPB 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpmA PE=3 SV=1 39 106 9.0E-11
sp|Q2J3K2|RL27_RHOP2 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpmA PE=3 SV=1 39 106 9.0E-11
sp|Q4UK85|RL27_RICFE 50S ribosomal protein L27 OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=rpmA PE=3 SV=1 37 106 1.0E-10
sp|Q07U70|RL27_RHOP5 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain BisA53) GN=rpmA PE=3 SV=1 39 106 1.0E-10
sp|A8F2N7|RL27_RICM5 50S ribosomal protein L27 OS=Rickettsia massiliae (strain Mtu5) GN=rpmA PE=3 SV=1 37 106 1.0E-10
sp|B3Q726|RL27_RHOPT 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpmA PE=3 SV=1 39 106 1.0E-10
sp|Q6NDE9|RL27_RHOPA 50S ribosomal protein L27 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpmA PE=1 SV=1 39 106 1.0E-10
sp|A6W353|RL27_MARMS 50S ribosomal protein L27 OS=Marinomonas sp. (strain MWYL1) GN=rpmA PE=3 SV=1 53 106 2.0E-10
sp|Q5P7Z5|RL27_AROAE 50S ribosomal protein L27 OS=Aromatoleum aromaticum (strain EbN1) GN=rpmA PE=3 SV=1 39 106 2.0E-10
sp|A8GTK7|RL27_RICRS 50S ribosomal protein L27 OS=Rickettsia rickettsii (strain Sheila Smith) GN=rpmA PE=3 SV=1 37 107 2.0E-10
sp|B0BV44|RL27_RICRO 50S ribosomal protein L27 OS=Rickettsia rickettsii (strain Iowa) GN=rpmA PE=3 SV=1 37 107 2.0E-10
sp|A6UDV3|RL27_SINMW 50S ribosomal protein L27 OS=Sinorhizobium medicae (strain WSM419) GN=rpmA PE=3 SV=1 39 106 2.0E-10
sp|B8EQH6|RL27_METSB 50S ribosomal protein L27 OS=Methylocella silvestris (strain BL2 / DSM 15510 / NCIMB 13906) GN=rpmA PE=3 SV=1 39 126 2.0E-10
sp|Q92LB7|RL27_RHIME 50S ribosomal protein L27 OS=Rhizobium meliloti (strain 1021) GN=rpmA PE=3 SV=1 39 106 2.0E-10
sp|Q11CP4|RL27_CHESB 50S ribosomal protein L27 OS=Chelativorans sp. (strain BNC1) GN=rpmA PE=3 SV=1 39 122 2.0E-10
sp|A8GPP8|RL27_RICAH 50S ribosomal protein L27 OS=Rickettsia akari (strain Hartford) GN=rpmA PE=3 SV=1 37 106 2.0E-10
sp|A6QB71|RL27_SULNB 50S ribosomal protein L27 OS=Sulfurovum sp. (strain NBC37-1) GN=rpmA PE=3 SV=1 54 106 3.0E-10
sp|Q3SVI4|RL27_NITWN 50S ribosomal protein L27 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpmA PE=3 SV=1 39 106 3.0E-10
sp|Q6G0T7|RL27_BARQU 50S ribosomal protein L27 OS=Bartonella quintana (strain Toulouse) GN=rpmA PE=3 SV=1 39 121 4.0E-10
sp|Q98EZ0|RL27_RHILO 50S ribosomal protein L27 OS=Rhizobium loti (strain MAFF303099) GN=rpmA PE=3 SV=1 39 121 4.0E-10
sp|C3PLM9|RL27_RICAE 50S ribosomal protein L27 OS=Rickettsia africae (strain ESF-5) GN=rpmA PE=3 SV=1 37 106 5.0E-10
sp|Q1QQU2|RL27_NITHX 50S ribosomal protein L27 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpmA PE=3 SV=1 39 106 5.0E-10
sp|A9H0E8|RL27_GLUDA 50S ribosomal protein L27 OS=Gluconacetobacter diazotrophicus (strain ATCC 49037 / DSM 5601 / PAl5) GN=rpmA PE=3 SV=1 39 108 5.0E-10
sp|Q8UBR6|RL27_AGRFC 50S ribosomal protein L27 OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=rpmA PE=3 SV=1 39 106 6.0E-10
sp|Q6MGS4|RL27_BDEBA 50S ribosomal protein L27 OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=rpmA PE=3 SV=1 39 108 6.0E-10
sp|B2UNV3|RL27_AKKM8 50S ribosomal protein L27 OS=Akkermansia muciniphila (strain ATCC BAA-835 / Muc) GN=rpmA PE=3 SV=1 53 109 6.0E-10
sp|B9L606|RL27_NAUPA 50S ribosomal protein L27 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpmA PE=3 SV=1 54 106 6.0E-10
sp|A4XJS7|RL27_CALS8 50S ribosomal protein L27 OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=rpmA PE=3 SV=1 30 106 6.0E-10
sp|B9MRB7|RL27_CALBD 50S ribosomal protein L27 OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=rpmA PE=3 SV=1 30 106 7.0E-10
sp|B8IEL7|RL27_METNO 50S ribosomal protein L27 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpmA PE=3 SV=1 39 115 9.0E-10
sp|Q54XK0|RM27_DICDI Probable 39S ribosomal protein L27, mitochondrial OS=Dictyostelium discoideum GN=mrpl27 PE=3 SV=1 34 121 1.0E-09
sp|Q6KHY5|RL27_MYCMO 50S ribosomal protein L27 OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=rpmA PE=3 SV=1 63 106 1.0E-09
sp|Q3IXY1|RL27_RHOS4 50S ribosomal protein L27 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=rpmA PE=3 SV=1 39 106 1.0E-09
sp|A3PQI8|RL27_RHOS1 50S ribosomal protein L27 OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=rpmA PE=3 SV=1 39 106 1.0E-09
sp|Q3SKG3|RL27_THIDA 50S ribosomal protein L27 OS=Thiobacillus denitrificans (strain ATCC 25259) GN=rpmA PE=3 SV=1 39 106 1.0E-09
sp|Q7VK83|RL27_HELHP 50S ribosomal protein L27 OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=rpmA PE=3 SV=1 54 106 1.0E-09
sp|C4K1G6|RL27_RICPU 50S ribosomal protein L27 OS=Rickettsia peacockii (strain Rustic) GN=rpmA PE=3 SV=1 37 106 1.0E-09
sp|Q5WTF0|RL27_LEGPL 50S ribosomal protein L27 OS=Legionella pneumophila (strain Lens) GN=rpmA PE=3 SV=1 39 121 1.0E-09
sp|Q5ZS69|RL27_LEGPH 50S ribosomal protein L27 OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=rpmA PE=3 SV=1 39 121 1.0E-09
sp|A5IAS6|RL27_LEGPC 50S ribosomal protein L27 OS=Legionella pneumophila (strain Corby) GN=rpmA PE=3 SV=1 39 121 1.0E-09
sp|Q5X1P0|RL27_LEGPA 50S ribosomal protein L27 OS=Legionella pneumophila (strain Paris) GN=rpmA PE=3 SV=1 39 121 1.0E-09
sp|Q92GG0|RL27_RICCN 50S ribosomal protein L27 OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=rpmA PE=3 SV=1 37 106 2.0E-09
sp|B6JD23|RL27_OLICO 50S ribosomal protein L27 OS=Oligotropha carboxidovorans (strain ATCC 49405 / DSM 1227 / OM5) GN=rpmA PE=3 SV=1 39 106 2.0E-09
sp|A5CF98|RL27_ORITB 50S ribosomal protein L27 OS=Orientia tsutsugamushi (strain Boryong) GN=rpmA PE=3 SV=1 37 123 2.0E-09
sp|Q8RBA7|RL27_CALS4 50S ribosomal protein L27 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpmA PE=3 SV=1 53 108 2.0E-09
sp|A1B9H4|RL27_PARDP 50S ribosomal protein L27 OS=Paracoccus denitrificans (strain Pd 1222) GN=rpmA PE=3 SV=1 39 106 2.0E-09
sp|Q7MA29|RL27_WOLSU 50S ribosomal protein L27 OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=rpmA PE=3 SV=1 54 108 2.0E-09
sp|Q9ZCI8|RL27_RICPR 50S ribosomal protein L27 OS=Rickettsia prowazekii (strain Madrid E) GN=rpmA PE=3 SV=1 37 106 3.0E-09
sp|Q0AAD7|RL27_ALKEH 50S ribosomal protein L27 OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=rpmA PE=3 SV=1 39 121 3.0E-09
sp|Q89X93|RL27_BRADU 50S ribosomal protein L27 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpmA PE=3 SV=1 39 106 3.0E-09
sp|A8LK04|RL27_DINSH 50S ribosomal protein L27 OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=rpmA PE=3 SV=1 39 108 3.0E-09
sp|Q47AD1|RL27_DECAR 50S ribosomal protein L27 OS=Dechloromonas aromatica (strain RCB) GN=rpmA PE=3 SV=1 39 106 3.0E-09
sp|Q68VZ8|RL27_RICTY 50S ribosomal protein L27 OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=rpmA PE=3 SV=1 37 106 4.0E-09
sp|Q1RGM8|RL27_RICBR 50S ribosomal protein L27 OS=Rickettsia bellii (strain RML369-C) GN=rpmA PE=3 SV=1 37 111 4.0E-09
sp|A8GYB3|RL27_RICB8 50S ribosomal protein L27 OS=Rickettsia bellii (strain OSU 85-389) GN=rpmA PE=3 SV=1 37 111 4.0E-09
sp|A4YKF6|RL27_BRASO 50S ribosomal protein L27 OS=Bradyrhizobium sp. (strain ORS278) GN=rpmA PE=3 SV=1 39 107 4.0E-09
sp|B2IE46|RL27_BEII9 50S ribosomal protein L27 OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=rpmA PE=3 SV=1 39 121 4.0E-09
sp|C0R0P3|RL27_BRAHW 50S ribosomal protein L27 OS=Brachyspira hyodysenteriae (strain ATCC 49526 / WA1) GN=rpmA PE=3 SV=1 39 109 4.0E-09
sp|Q2RV03|RL27_RHORT 50S ribosomal protein L27 OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=rpmA PE=3 SV=1 39 108 4.0E-09
sp|A5E968|RL27_BRASB 50S ribosomal protein L27 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpmA PE=3 SV=1 39 107 4.0E-09
sp|A6Q4D3|RL27_NITSB 50S ribosomal protein L27 OS=Nitratiruptor sp. (strain SB155-2) GN=rpmA PE=3 SV=1 54 108 6.0E-09
sp|Q21M08|RL27_SACD2 50S ribosomal protein L27 OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=rpmA PE=3 SV=1 39 121 6.0E-09
sp|B5YJ66|RL27_THEYD 50S ribosomal protein L27 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpmA PE=3 SV=1 54 108 6.0E-09
sp|B3CV08|RL27_ORITI 50S ribosomal protein L27 OS=Orientia tsutsugamushi (strain Ikeda) GN=rpmA PE=3 SV=1 37 123 6.0E-09
sp|B0SRT6|RL27_LEPBP 50S ribosomal protein L27 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=rpmA PE=3 SV=1 37 106 6.0E-09
sp|B0S9A2|RL27_LEPBA 50S ribosomal protein L27 OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=rpmA PE=3 SV=1 37 106 6.0E-09
sp|Q1GRH1|RL27_SPHAL 50S ribosomal protein L27 OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=rpmA PE=3 SV=1 39 126 6.0E-09
sp|B0UMS2|RL27_METS4 50S ribosomal protein L27 OS=Methylobacterium sp. (strain 4-46) GN=rpmA PE=3 SV=1 39 106 6.0E-09
sp|C4L4N3|RL27_EXISA 50S ribosomal protein L27 OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=rpmA PE=3 SV=1 35 108 6.0E-09
sp|A9KMF6|RL27_CLOPH 50S ribosomal protein L27 OS=Clostridium phytofermentans (strain ATCC 700394 / DSM 18823 / ISDg) GN=rpmA PE=3 SV=1 53 108 6.0E-09
sp|A0M7D0|RL27_GRAFK 50S ribosomal protein L27 OS=Gramella forsetii (strain KT0803) GN=rpmA PE=3 SV=1 53 111 7.0E-09
sp|Q5FUL3|RL27_GLUOX 50S ribosomal protein L27 OS=Gluconobacter oxydans (strain 621H) GN=rpmA PE=3 SV=1 39 108 8.0E-09
sp|Q8FYL8|RL27_BRUSU 50S ribosomal protein L27 OS=Brucella suis biovar 1 (strain 1330) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|A9WWX2|RL27_BRUSI 50S ribosomal protein L27 OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|A5VSI8|RL27_BRUO2 50S ribosomal protein L27 OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|C0RF97|RL27_BRUMB 50S ribosomal protein L27 OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|A9M886|RL27_BRUC2 50S ribosomal protein L27 OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|Q8VW58|RL27_BRUAB 50S ribosomal protein L27 OS=Brucella abortus biovar 1 (strain 9-941) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|Q2YLL8|RL27_BRUA2 50S ribosomal protein L27 OS=Brucella abortus (strain 2308) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|B2S810|RL27_BRUA1 50S ribosomal protein L27 OS=Brucella abortus (strain S19) GN=rpmA PE=3 SV=1 39 106 8.0E-09
sp|B9K8D0|RL27_THENN 50S ribosomal protein L27 OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NS-E) GN=rpmA PE=3 SV=1 39 121 8.0E-09
sp|A1URM7|RL27_BARBK 50S ribosomal protein L27 OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=rpmA PE=3 SV=1 39 121 1.0E-08
sp|A7HT69|RL27_PARL1 50S ribosomal protein L27 OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=rpmA PE=3 SV=1 39 106 1.0E-08
sp|Q5KWP3|RL27_GEOKA 50S ribosomal protein L27 OS=Geobacillus kaustophilus (strain HTA426) GN=rpmA PE=3 SV=1 35 108 1.0E-08
sp|A5FJP6|RL27_FLAJ1 50S ribosomal protein L27 OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=rpmA PE=3 SV=1 53 111 1.0E-08
sp|A6H1P8|RL27_FLAPJ 50S ribosomal protein L27 OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=rpmA PE=3 SV=1 46 121 1.0E-08
sp|B9KER2|RL27_CAMLR 50S ribosomal protein L27 OS=Campylobacter lari (strain RM2100 / D67 / ATCC BAA-1060) GN=rpmA PE=3 SV=1 36 121 1.0E-08
sp|Q8YJ84|RL27_BRUME 50S ribosomal protein L27 OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=rpmA PE=3 SV=1 41 106 1.0E-08
sp|B0K416|RL27_THEPX 50S ribosomal protein L27 OS=Thermoanaerobacter sp. (strain X514) GN=rpmA PE=3 SV=1 53 108 1.0E-08
sp|B0KAC0|RL27_THEP3 50S ribosomal protein L27 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpmA PE=3 SV=1 53 108 1.0E-08
sp|C5D5G7|RL27_GEOSW 50S ribosomal protein L27 OS=Geobacillus sp. (strain WCH70) GN=rpmA PE=3 SV=1 35 108 1.0E-08
sp|B5ELU3|RL27_ACIF5 50S ribosomal protein L27 OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=rpmA PE=3 SV=1 39 116 2.0E-08
sp|B7J428|RL27_ACIF2 50S ribosomal protein L27 OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=rpmA PE=3 SV=1 39 116 2.0E-08
sp|Q17Y99|RL27_HELAH 50S ribosomal protein L27 OS=Helicobacter acinonychis (strain Sheeba) GN=rpmA PE=3 SV=1 54 109 2.0E-08
sp|Q3YRY1|RL27_EHRCJ 50S ribosomal protein L27 OS=Ehrlichia canis (strain Jake) GN=rpmA PE=3 SV=1 37 108 2.0E-08
sp|Q2GCN3|RL27_NEOSM 50S ribosomal protein L27 OS=Neorickettsia sennetsu (strain Miyayama) GN=rpmA PE=3 SV=1 37 106 2.0E-08
sp|Q2S9T2|RL27_HAHCH 50S ribosomal protein L27 OS=Hahella chejuensis (strain KCTC 2396) GN=rpmA PE=3 SV=1 54 106 2.0E-08
sp|Q5HX71|RL27_CAMJR 50S ribosomal protein L27 OS=Campylobacter jejuni (strain RM1221) GN=rpmA PE=3 SV=1 36 121 2.0E-08
sp|A1VXH8|RL27_CAMJJ 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=rpmA PE=3 SV=1 36 121 2.0E-08
sp|Q9PJ31|RL27_CAMJE 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=rpmA PE=3 SV=1 36 121 2.0E-08
sp|A7H1G9|RL27_CAMJD 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=rpmA PE=3 SV=1 36 121 2.0E-08
sp|A8FJQ0|RL27_CAMJ8 50S ribosomal protein L27 OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=rpmA PE=3 SV=1 36 121 2.0E-08
sp|B9L2M3|RL27_THERP 50S ribosomal protein L27 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpmA PE=3 SV=1 54 106 2.0E-08
sp|A7ZC11|RL27_CAMC1 50S ribosomal protein L27 OS=Campylobacter concisus (strain 13826) GN=rpmA PE=3 SV=1 36 108 2.0E-08
sp|B0T395|RL27_CAUSK 50S ribosomal protein L27 OS=Caulobacter sp. (strain K31) GN=rpmA PE=3 SV=1 39 121 2.0E-08
sp|Q2G9U8|RL27_NOVAD 50S ribosomal protein L27 OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=rpmA PE=3 SV=1 39 126 2.0E-08
sp|Q6F8G2|RL27_ACIAD 50S ribosomal protein L27 OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=rpmA PE=3 SV=1 39 106 2.0E-08
sp|B6IR00|RL27_RHOCS 50S ribosomal protein L27 OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=rpmA PE=3 SV=1 39 107 2.0E-08
sp|B0VEJ5|RL27_ACIBY 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AYE) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|A3M899|RL27_ACIBT 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|B0VSH6|RL27_ACIBS 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain SDF) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|B2HXU8|RL27_ACIBC 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain ACICU) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|B7I6V8|RL27_ACIB5 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AB0057) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|B7GXH9|RL27_ACIB3 50S ribosomal protein L27 OS=Acinetobacter baumannii (strain AB307-0294) GN=rpmA PE=3 SV=1 37 106 3.0E-08
sp|Q1IW73|RL27_DEIGD 50S ribosomal protein L27 OS=Deinococcus geothermalis (strain DSM 11300) GN=rpmA PE=3 SV=1 53 106 3.0E-08
sp|A9BP69|RL27_DELAS 50S ribosomal protein L27 OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=rpmA PE=3 SV=1 39 106 3.0E-08
sp|B2A6B5|RL27_NATTJ 50S ribosomal protein L27 OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=rpmA PE=3 SV=1 35 106 3.0E-08
sp|B5RQB7|RL27_BORRA 50S ribosomal protein L27 OS=Borrelia recurrentis (strain A1) GN=rpmA PE=3 SV=1 37 121 3.0E-08
sp|B5RMX2|RL27_BORDL 50S ribosomal protein L27 OS=Borrelia duttonii (strain Ly) GN=rpmA PE=3 SV=1 37 121 3.0E-08
sp|B7GNK2|RL27_BIFLS 50S ribosomal protein L27 OS=Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12) GN=rpmA PE=3 SV=1 53 106 3.0E-08
sp|Q8G4U1|RL27_BIFLO 50S ribosomal protein L27 OS=Bifidobacterium longum (strain NCC 2705) GN=rpmA PE=3 SV=1 53 106 3.0E-08
sp|B3DPS3|RL27_BIFLD 50S ribosomal protein L27 OS=Bifidobacterium longum (strain DJO10A) GN=rpmA PE=3 SV=1 53 106 3.0E-08
sp|A6WXR7|RL27_OCHA4 50S ribosomal protein L27 OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=rpmA PE=3 SV=1 39 106 3.0E-08
sp|Q5LRY1|RL27_RUEPO 50S ribosomal protein L27 OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=rpmA PE=3 SV=1 39 121 3.0E-08
sp|A1R0K3|RL27_BORT9 50S ribosomal protein L27 OS=Borrelia turicatae (strain 91E135) GN=rpmA PE=3 SV=1 37 121 3.0E-08
sp|A6LQR8|RL27_CLOB8 50S ribosomal protein L27 OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=rpmA PE=3 SV=1 53 108 4.0E-08
sp|A7H030|RL27_CAMC5 50S ribosomal protein L27 OS=Campylobacter curvus (strain 525.92) GN=rpmA PE=3 SV=1 36 121 4.0E-08
sp|Q0AKX6|RL27_MARMM 50S ribosomal protein L27 OS=Maricaulis maris (strain MCS10) GN=rpmA PE=3 SV=1 39 108 4.0E-08
sp|Q2VZU3|RL27_MAGSA 50S ribosomal protein L27 OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=rpmA PE=3 SV=1 39 106 4.0E-08
sp|Q8REI3|RL27_FUSNN 50S ribosomal protein L27 OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=rpmA PE=3 SV=1 35 108 4.0E-08
sp|Q2GK21|RL27_ANAPZ 50S ribosomal protein L27 OS=Anaplasma phagocytophilum (strain HZ) GN=rpmA PE=3 SV=1 54 108 4.0E-08
sp|Q747N0|RL27_GEOSL 50S ribosomal protein L27 OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=rpmA PE=3 SV=1 53 108 4.0E-08
sp|Q3A1D7|RL27_PELCD 50S ribosomal protein L27 OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=rpmA PE=3 SV=1 39 108 4.0E-08
sp|Q2NCD6|RL27_ERYLH 50S ribosomal protein L27 OS=Erythrobacter litoralis (strain HTCC2594) GN=rpmA PE=3 SV=1 39 126 5.0E-08
sp|Q3Z6W2|RL27_DEHM1 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=rpmA PE=3 SV=1 53 117 6.0E-08
sp|Q4ZYK2|RL27_PSEU2 50S ribosomal protein L27 OS=Pseudomonas syringae pv. syringae (strain B728a) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|Q889F2|RL27_PSESM 50S ribosomal protein L27 OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|Q48NL3|RL27_PSE14 50S ribosomal protein L27 OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|Q39QR5|RL27_GEOMG 50S ribosomal protein L27 OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=rpmA PE=3 SV=1 53 108 6.0E-08
sp|O67650|RL27_AQUAE 50S ribosomal protein L27 OS=Aquifex aeolicus (strain VF5) GN=rpmA PE=3 SV=1 39 106 6.0E-08
sp|Q8CS89|RL27_STAES 50S ribosomal protein L27 OS=Staphylococcus epidermidis (strain ATCC 12228) GN=rpmA PE=3 SV=1 31 108 6.0E-08
sp|Q5HNQ6|RL27_STAEQ 50S ribosomal protein L27 OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=rpmA PE=3 SV=1 31 108 6.0E-08
sp|A5FV28|RL27_ACICJ 50S ribosomal protein L27 OS=Acidiphilium cryptum (strain JF-5) GN=rpmA PE=3 SV=1 39 108 6.0E-08
sp|Q5H2E6|RL27_XANOR 50S ribosomal protein L27 OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|B2STB9|RL27_XANOP 50S ribosomal protein L27 OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|Q2P5B5|RL27_XANOM 50S ribosomal protein L27 OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|A5GD28|RL27_GEOUR 50S ribosomal protein L27 OS=Geobacter uraniireducens (strain Rf4) GN=rpmA PE=3 SV=1 54 108 6.0E-08
sp|C1D505|RL27_LARHH 50S ribosomal protein L27 OS=Laribacter hongkongensis (strain HLHK9) GN=rpmA PE=3 SV=1 53 106 6.0E-08
sp|B2JHD8|RL27_BURP8 50S ribosomal protein L27 OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=rpmA PE=3 SV=1 53 106 7.0E-08
sp|A4JBB7|RL27_BURVG 50S ribosomal protein L27 OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|Q39JU8|RL27_BURL3 50S ribosomal protein L27 OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|Q0BIH9|RL27_BURCM 50S ribosomal protein L27 OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|B4E5X1|RL27_BURCJ 50S ribosomal protein L27 OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|A0K4A9|RL27_BURCH 50S ribosomal protein L27 OS=Burkholderia cenocepacia (strain HI2424) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|B1JVA0|RL27_BURCC 50S ribosomal protein L27 OS=Burkholderia cenocepacia (strain MC0-3) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|Q1BZE1|RL27_BURCA 50S ribosomal protein L27 OS=Burkholderia cenocepacia (strain AU 1054) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|B1YSU6|RL27_BURA4 50S ribosomal protein L27 OS=Burkholderia ambifaria (strain MC40-6) GN=rpmA PE=3 SV=1 39 106 7.0E-08
sp|A8FFT0|RL27_BACP2 50S ribosomal protein L27 OS=Bacillus pumilus (strain SAFR-032) GN=rpmA PE=3 SV=1 35 108 7.0E-08
sp|A5WDV1|RL27_PSYWF 50S ribosomal protein L27 OS=Psychrobacter sp. (strain PRwf-1) GN=rpmA PE=3 SV=1 53 121 8.0E-08
sp|C3M9X6|RL27_RHISN 50S ribosomal protein L27 OS=Rhizobium sp. (strain NGR234) GN=rpmA PE=3 SV=1 39 106 8.0E-08
sp|C4Z9Z8|RL27_EUBR3 50S ribosomal protein L27 OS=Eubacterium rectale (strain ATCC 33656 / VPI 0990) GN=rpmA PE=3 SV=1 53 108 8.0E-08
sp|Q3BW47|RL27_XANC5 50S ribosomal protein L27 OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rpmA PE=3 SV=1 53 106 8.0E-08
sp|Q8PN24|RL27_XANAC 50S ribosomal protein L27 OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rpmA PE=3 SV=1 53 106 8.0E-08
sp|A9AI61|RL27_BURM1 50S ribosomal protein L27 OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=rpmA PE=3 SV=1 39 106 8.0E-08
sp|Q65GM5|RL27_BACLD 50S ribosomal protein L27 OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=rpmA PE=3 SV=1 35 108 8.0E-08
sp|Q3IFF5|RL27_PSEHT 50S ribosomal protein L27 OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=rpmA PE=3 SV=1 53 121 8.0E-08
sp|Q28Q14|RL27_JANSC 50S ribosomal protein L27 OS=Jannaschia sp. (strain CCS1) GN=rpmA PE=3 SV=1 39 106 8.0E-08
sp|B3E330|RL27_GEOLS 50S ribosomal protein L27 OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=rpmA PE=3 SV=1 54 108 8.0E-08
sp|P07844|RL27_GEOSE 50S ribosomal protein L27 OS=Geobacillus stearothermophilus GN=rpmA PE=1 SV=2 46 108 9.0E-08
sp|A7Z783|RL27_BACMF 50S ribosomal protein L27 OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=rpmA PE=3 SV=1 35 108 9.0E-08
sp|Q9CNS7|RL27_PASMU 50S ribosomal protein L27 OS=Pasteurella multocida (strain Pm70) GN=rpmA PE=3 SV=1 37 121 9.0E-08
sp|B7GIR0|RL27_ANOFW 50S ribosomal protein L27 OS=Anoxybacillus flavithermus (strain DSM 21510 / WK1) GN=rpmA PE=3 SV=1 35 108 9.0E-08
sp|Q4L6Z1|RL27_STAHJ 50S ribosomal protein L27 OS=Staphylococcus haemolyticus (strain JCSC1435) GN=rpmA PE=3 SV=1 31 108 9.0E-08
sp|C1A930|RL27_GEMAT 50S ribosomal protein L27 OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=rpmA PE=3 SV=1 53 106 9.0E-08
sp|C3K1X7|RL27_PSEFS 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain SBW25) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|P05657|RL27_BACSU 50S ribosomal protein L27 OS=Bacillus subtilis (strain 168) GN=rpmA PE=1 SV=1 35 108 1.0E-07
sp|Q2GGS4|RL27_EHRCR 50S ribosomal protein L27 OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=rpmA PE=3 SV=1 37 108 1.0E-07
sp|A6L6D2|RL27_BACV8 50S ribosomal protein L27 OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=rpmA PE=3 SV=1 46 104 1.0E-07
sp|Q605N3|RL27_METCA 50S ribosomal protein L27 OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=rpmA PE=3 SV=1 39 121 1.0E-07
sp|Q2SZG1|RL27_BURTA 50S ribosomal protein L27 OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|Q9FD28|RL27_BURPS 50S ribosomal protein L27 OS=Burkholderia pseudomallei (strain K96243) GN=rpmA PE=3 SV=2 53 106 1.0E-07
sp|A3NDS9|RL27_BURP6 50S ribosomal protein L27 OS=Burkholderia pseudomallei (strain 668) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|Q3JNF9|RL27_BURP1 50S ribosomal protein L27 OS=Burkholderia pseudomallei (strain 1710b) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|A3NZJ1|RL27_BURP0 50S ribosomal protein L27 OS=Burkholderia pseudomallei (strain 1106a) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|A1V0P2|RL27_BURMS 50S ribosomal protein L27 OS=Burkholderia mallei (strain SAVP1) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|Q62GV3|RL27_BURMA 50S ribosomal protein L27 OS=Burkholderia mallei (strain ATCC 23344) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|A2S5R9|RL27_BURM9 50S ribosomal protein L27 OS=Burkholderia mallei (strain NCTC 10229) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|A3MR89|RL27_BURM7 50S ribosomal protein L27 OS=Burkholderia mallei (strain NCTC 10247) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|Q8PBH1|RL27_XANCP 50S ribosomal protein L27 OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|B0RY33|RL27_XANCB 50S ribosomal protein L27 OS=Xanthomonas campestris pv. campestris (strain B100) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|Q4US35|RL27_XANC8 50S ribosomal protein L27 OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpmA PE=3 SV=1 53 106 1.0E-07
sp|C5BQB3|RL27_TERTT 50S ribosomal protein L27 OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=rpmA PE=3 SV=1 53 122 1.0E-07
sp|B9M3W2|RL27_GEODF 50S ribosomal protein L27 OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=rpmA PE=3 SV=1 54 108 1.0E-07
sp|A1VF57|RL27_DESVV 50S ribosomal protein L27 OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=rpmA PE=3 SV=1 57 106 1.0E-07
sp|Q72DK1|RL27_DESVH 50S ribosomal protein L27 OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=rpmA PE=3 SV=1 57 106 1.0E-07
sp|A5UI24|RL27_HAEIG 50S ribosomal protein L27 OS=Haemophilus influenzae (strain PittGG) GN=rpmA PE=3 SV=1 37 121 1.0E-07
sp|A5UDJ5|RL27_HAEIE 50S ribosomal protein L27 OS=Haemophilus influenzae (strain PittEE) GN=rpmA PE=3 SV=1 37 121 1.0E-07
sp|Q4QM29|RL27_HAEI8 50S ribosomal protein L27 OS=Haemophilus influenzae (strain 86-028NP) GN=rpmA PE=3 SV=1 37 121 1.0E-07
sp|Q5PAS8|RL27_ANAMM 50S ribosomal protein L27 OS=Anaplasma marginale (strain St. Maries) GN=rpmA PE=3 SV=1 37 108 1.0E-07
sp|B9KIJ4|RL27_ANAMF 50S ribosomal protein L27 OS=Anaplasma marginale (strain Florida) GN=rpmA PE=3 SV=1 37 108 1.0E-07
sp|A7I2Z9|RL27_CAMHC 50S ribosomal protein L27 OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=rpmA PE=3 SV=1 36 108 1.0E-07
sp|B2V8X4|RL27_SULSY 50S ribosomal protein L27 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpmA PE=3 SV=1 39 106 1.0E-07
sp|C5CDI0|RL27_KOSOT 50S ribosomal protein L27 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpmA PE=3 SV=1 53 121 2.0E-07
sp|Q65S55|RL27_MANSM 50S ribosomal protein L27 OS=Mannheimia succiniciproducens (strain MBEL55E) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A6VMT9|RL27_ACTSZ 50S ribosomal protein L27 OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A6L8T0|RL27_PARD8 50S ribosomal protein L27 OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=rpmA PE=3 SV=1 46 108 2.0E-07
sp|Q8EPP8|RL27_OCEIH 50S ribosomal protein L27 OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=rpmA PE=3 SV=1 31 108 2.0E-07
sp|Q1Q9X2|RL27_PSYCK 50S ribosomal protein L27 OS=Psychrobacter cryohalolentis (strain K5) GN=rpmA PE=3 SV=1 53 106 2.0E-07
sp|Q4FRD8|RL27_PSYA2 50S ribosomal protein L27 OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=rpmA PE=3 SV=1 53 106 2.0E-07
sp|B2S1C2|RL27_BORHD 50S ribosomal protein L27 OS=Borrelia hermsii (strain HS1 / DAH) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A0ZZY9|RL27_BIFAA 50S ribosomal protein L27 OS=Bifidobacterium adolescentis (strain ATCC 15703 / DSM 20083 / NCTC 11814 / E194a) GN=rpmA PE=3 SV=1 56 106 2.0E-07
sp|P66131|RL27_SALTY 50S ribosomal protein L27 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rpmA PE=3 SV=2 53 122 2.0E-07
sp|P66132|RL27_SALTI 50S ribosomal protein L27 OS=Salmonella typhi GN=rpmA PE=3 SV=2 53 122 2.0E-07
sp|B4TWF5|RL27_SALSV 50S ribosomal protein L27 OS=Salmonella schwarzengrund (strain CVM19633) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B5BGK9|RL27_SALPK 50S ribosomal protein L27 OS=Salmonella paratyphi A (strain AKU_12601) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|C0PZJ7|RL27_SALPC 50S ribosomal protein L27 OS=Salmonella paratyphi C (strain RKS4594) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|A9N752|RL27_SALPB 50S ribosomal protein L27 OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|Q5PLB5|RL27_SALPA 50S ribosomal protein L27 OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=rpmA PE=3 SV=3 53 122 2.0E-07
sp|B4T716|RL27_SALNS 50S ribosomal protein L27 OS=Salmonella newport (strain SL254) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B4TJ23|RL27_SALHS 50S ribosomal protein L27 OS=Salmonella heidelberg (strain SL476) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B5REQ1|RL27_SALG2 50S ribosomal protein L27 OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B5R0H6|RL27_SALEP 50S ribosomal protein L27 OS=Salmonella enteritidis PT4 (strain P125109) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B5FIN4|RL27_SALDC 50S ribosomal protein L27 OS=Salmonella dublin (strain CT_02021853) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|Q57JG5|RL27_SALCH 50S ribosomal protein L27 OS=Salmonella choleraesuis (strain SC-B67) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|A9MP21|RL27_SALAR 50S ribosomal protein L27 OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|B5F6V4|RL27_SALA4 50S ribosomal protein L27 OS=Salmonella agona (strain SL483) GN=rpmA PE=3 SV=1 53 122 2.0E-07
sp|Q7MX94|RL27_PORGI 50S ribosomal protein L27 OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=rpmA PE=3 SV=1 53 121 2.0E-07
sp|B2RLC1|RL27_PORG3 50S ribosomal protein L27 OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=rpmA PE=3 SV=1 53 121 2.0E-07
sp|Q2Y808|RL27_NITMU 50S ribosomal protein L27 OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=rpmA PE=3 SV=1 39 106 2.0E-07
sp|Q8EVW5|RL27_MYCPE 50S ribosomal protein L27 OS=Mycoplasma penetrans (strain HF-2) GN=rpmA PE=3 SV=1 35 120 2.0E-07
sp|Q13U14|RL27_BURXL 50S ribosomal protein L27 OS=Burkholderia xenovorans (strain LB400) GN=rpmA PE=3 SV=1 39 106 2.0E-07
sp|B1Y281|RL27_LEPCP 50S ribosomal protein L27 OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=rpmA PE=3 SV=1 39 122 2.0E-07
sp|B8F874|RL27_HAEPS 50S ribosomal protein L27 OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A8EV84|RL27_ARCB4 50S ribosomal protein L27 OS=Arcobacter butzleri (strain RM4018) GN=rpmA PE=3 SV=1 53 106 2.0E-07
sp|A1VK91|RL27_POLNA 50S ribosomal protein L27 OS=Polaromonas naphthalenivorans (strain CJ2) GN=rpmA PE=3 SV=1 39 106 2.0E-07
sp|B0BU26|RL27_ACTPJ 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|B3GZE6|RL27_ACTP7 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A3N3T8|RL27_ACTP2 50S ribosomal protein L27 OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|A1RMV7|RL27_SHESW 50S ribosomal protein L27 OS=Shewanella sp. (strain W3-18-1) GN=rpmA PE=3 SV=1 39 121 2.0E-07
sp|A0L073|RL27_SHESA 50S ribosomal protein L27 OS=Shewanella sp. (strain ANA-3) GN=rpmA PE=3 SV=1 39 121 2.0E-07
sp|A4Y426|RL27_SHEPC 50S ribosomal protein L27 OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=rpmA PE=3 SV=1 39 121 2.0E-07
sp|Q8EB81|RL27_SHEON 50S ribosomal protein L27 OS=Shewanella oneidensis (strain MR-1) GN=rpmA PE=3 SV=1 39 121 2.0E-07
sp|Q5HB48|RL27_EHRRW 50S ribosomal protein L27 OS=Ehrlichia ruminantium (strain Welgevonden) GN=rpmA PE=3 SV=1 37 108 2.0E-07
sp|Q5FH97|RL27_EHRRG 50S ribosomal protein L27 OS=Ehrlichia ruminantium (strain Gardel) GN=rpmA PE=3 SV=1 37 108 2.0E-07
sp|Q4FP47|RL27_PELUB 50S ribosomal protein L27 OS=Pelagibacter ubique (strain HTCC1062) GN=rpmA PE=3 SV=1 37 108 2.0E-07
sp|Q7VP91|RL27_HAEDU 50S ribosomal protein L27 OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=rpmA PE=3 SV=1 37 121 2.0E-07
sp|B1KGH0|RL27_SHEWM 50S ribosomal protein L27 OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=rpmA PE=3 SV=1 39 121 2.0E-07
sp|A9L429|RL27_SHEB9 50S ribosomal protein L27 OS=Shewanella baltica (strain OS195) GN=rpmA PE=3 SV=1 39 106 3.0E-07
sp|A6WK50|RL27_SHEB8 50S ribosomal protein L27 OS=Shewanella baltica (strain OS185) GN=rpmA PE=3 SV=1 39 106 3.0E-07
sp|A3D179|RL27_SHEB5 50S ribosomal protein L27 OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=rpmA PE=3 SV=1 39 106 3.0E-07
sp|B8EC05|RL27_SHEB2 50S ribosomal protein L27 OS=Shewanella baltica (strain OS223) GN=rpmA PE=3 SV=1 39 106 3.0E-07
sp|P44363|RL27_HAEIN 50S ribosomal protein L27 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=rpmA PE=3 SV=2 37 119 3.0E-07
sp|A8FRU3|RL27_SHESH 50S ribosomal protein L27 OS=Shewanella sediminis (strain HAW-EB3) GN=rpmA PE=3 SV=1 39 121 3.0E-07
sp|Q98QN2|RL27_MYCPU 50S ribosomal protein L27 OS=Mycoplasma pulmonis (strain UAB CTIP) GN=rpmA PE=3 SV=1 54 121 3.0E-07
sp|Q10ZG7|RL27_TRIEI 50S ribosomal protein L27 OS=Trichodesmium erythraeum (strain IMS101) GN=rpmA PE=3 SV=1 53 108 3.0E-07
sp|Q99N92|RM27_MOUSE 39S ribosomal protein L27, mitochondrial OS=Mus musculus GN=Mrpl27 PE=1 SV=1 18 109 3.0E-07
sp|B7J0M6|RL27_BORBZ 50S ribosomal protein L27 OS=Borrelia burgdorferi (strain ZS7) GN=rpmA PE=3 SV=1 37 106 3.0E-07
sp|O51721|RL27_BORBU 50S ribosomal protein L27 OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=rpmA PE=3 SV=1 37 106 3.0E-07
sp|Q0SM74|RL27_BORAP 50S ribosomal protein L27 OS=Borrelia afzelii (strain PKo) GN=rpmA PE=3 SV=1 37 106 3.0E-07
sp|Q07YI9|RL27_SHEFN 50S ribosomal protein L27 OS=Shewanella frigidimarina (strain NCIMB 400) GN=rpmA PE=3 SV=1 39 121 3.0E-07
sp|Q165Y3|RL27_ROSDO 50S ribosomal protein L27 OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=rpmA PE=3 SV=1 39 108 3.0E-07
sp|B0UVI0|RL27_HISS2 50S ribosomal protein L27 OS=Histophilus somni (strain 2336) GN=rpmA PE=3 SV=1 37 121 3.0E-07
sp|Q0I1P7|RL27_HAES1 50S ribosomal protein L27 OS=Haemophilus somnus (strain 129Pt) GN=rpmA PE=3 SV=1 37 121 3.0E-07
sp|Q0HRZ7|RL27_SHESR 50S ribosomal protein L27 OS=Shewanella sp. (strain MR-7) GN=rpmA PE=3 SV=1 39 121 3.0E-07
sp|Q0HLU1|RL27_SHESM 50S ribosomal protein L27 OS=Shewanella sp. (strain MR-4) GN=rpmA PE=3 SV=1 39 121 3.0E-07
sp|A1S9H4|RL27_SHEAM 50S ribosomal protein L27 OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=rpmA PE=3 SV=1 39 121 3.0E-07
sp|C5CXX4|RL27_VARPS 50S ribosomal protein L27 OS=Variovorax paradoxus (strain S110) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|Q0BRF0|RL27_GRABC 50S ribosomal protein L27 OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=rpmA PE=3 SV=1 54 108 4.0E-07
sp|A3QB94|RL27_SHELP 50S ribosomal protein L27 OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=rpmA PE=3 SV=1 39 121 4.0E-07
sp|Q32PC3|RM27_BOVIN 39S ribosomal protein L27, mitochondrial OS=Bos taurus GN=MRPL27 PE=1 SV=1 29 109 4.0E-07
sp|Q89ZR3|RL27_BACTN 50S ribosomal protein L27 OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=rpmA PE=3 SV=1 46 106 4.0E-07
sp|Q8F7U1|RL27_LEPIN 50S ribosomal protein L27 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|Q72NQ6|RL27_LEPIC 50S ribosomal protein L27 OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|Q054P5|RL27_LEPBL 50S ribosomal protein L27 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|Q04Q89|RL27_LEPBJ 50S ribosomal protein L27 OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|C6E8U2|RL27_GEOSM 50S ribosomal protein L27 OS=Geobacter sp. (strain M21) GN=rpmA PE=3 SV=1 54 108 4.0E-07
sp|Q3AS97|RL27_CHLCH 50S ribosomal protein L27 OS=Chlorobium chlorochromatii (strain CaD3) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|B5E957|RL27_GEOBB 50S ribosomal protein L27 OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=rpmA PE=3 SV=1 54 108 4.0E-07
sp|B8DRP0|RL27_DESVM 50S ribosomal protein L27 OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=rpmA PE=3 SV=1 39 119 4.0E-07
sp|Q7MP93|RL27_VIBVY 50S ribosomal protein L27 OS=Vibrio vulnificus (strain YJ016) GN=rpmA PE=3 SV=1 39 121 4.0E-07
sp|Q8DEC5|RL27_VIBVU 50S ribosomal protein L27 OS=Vibrio vulnificus (strain CMCP6) GN=rpmA PE=3 SV=1 39 121 4.0E-07
sp|B8GQQ2|RL27_THISH 50S ribosomal protein L27 OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=rpmA PE=3 SV=1 39 121 4.0E-07
sp|A7NKS0|RL27_ROSCS 50S ribosomal protein L27 OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=rpmA PE=3 SV=1 53 117 4.0E-07
sp|Q12K22|RL27_SHEDO 50S ribosomal protein L27 OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=rpmA PE=3 SV=1 39 121 4.0E-07
sp|A1TTD4|RL27_ACIAC 50S ribosomal protein L27 OS=Acidovorax citrulli (strain AAC00-1) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|B8CSY4|RL27_SHEPW 50S ribosomal protein L27 OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|A8H0U3|RL27_SHEPA 50S ribosomal protein L27 OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|B0TUI1|RL27_SHEHH 50S ribosomal protein L27 OS=Shewanella halifaxensis (strain HAW-EB4) GN=rpmA PE=3 SV=1 39 106 4.0E-07
sp|B8J4L4|RL27_DESDA 50S ribosomal protein L27 OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=rpmA PE=3 SV=1 39 106 5.0E-07
sp|B8E0B3|RL27_DICTD 50S ribosomal protein L27 OS=Dictyoglomus turgidum (strain Z-1310 / DSM 6724) GN=rpmA PE=3 SV=1 39 121 5.0E-07
sp|A5UWR7|RL27_ROSS1 50S ribosomal protein L27 OS=Roseiflexus sp. (strain RS-1) GN=rpmA PE=3 SV=1 53 117 5.0E-07
sp|B4SFQ9|RL27_PELPB 50S ribosomal protein L27 OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=rpmA PE=3 SV=1 39 106 5.0E-07
sp|A4XYL3|RL27_PSEMY 50S ribosomal protein L27 OS=Pseudomonas mendocina (strain ymp) GN=rpmA PE=3 SV=1 53 106 5.0E-07
sp|B0TYK1|RL27_FRAP2 50S ribosomal protein L27 OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=rpmA PE=3 SV=1 39 107 5.0E-07
sp|Q12F98|RL27_POLSJ 50S ribosomal protein L27 OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=rpmA PE=3 SV=1 39 106 5.0E-07
sp|B1LBJ4|RL27_THESQ 50S ribosomal protein L27 OS=Thermotoga sp. (strain RQ2) GN=rpmA PE=3 SV=1 39 121 5.0E-07
sp|A5IMC9|RL27_THEP1 50S ribosomal protein L27 OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=rpmA PE=3 SV=1 39 121 5.0E-07
sp|Q9X1G7|RL27_THEMA 50S ribosomal protein L27 OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=rpmA PE=3 SV=1 39 121 5.0E-07
sp|Q9P0M9|RM27_HUMAN 39S ribosomal protein L27, mitochondrial OS=Homo sapiens GN=MRPL27 PE=1 SV=1 27 116 5.0E-07
sp|B4RD67|RL27_PHEZH 50S ribosomal protein L27 OS=Phenylobacterium zucineum (strain HLK1) GN=rpmA PE=3 SV=1 39 112 5.0E-07
sp|B2IV09|RL27_NOSP7 50S ribosomal protein L27 OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=rpmA PE=3 SV=1 54 123 6.0E-07
sp|A1AKW2|RL27_PELPD 50S ribosomal protein L27 OS=Pelobacter propionicus (strain DSM 2379) GN=rpmA PE=3 SV=1 54 108 6.0E-07
sp|Q47MV5|RL27_THEFY 50S ribosomal protein L27 OS=Thermobifida fusca (strain YX) GN=rpmA PE=3 SV=1 54 106 6.0E-07
sp|Q0AHG6|RL27_NITEC 50S ribosomal protein L27 OS=Nitrosomonas eutropha (strain C91) GN=rpmA PE=3 SV=1 39 106 6.0E-07
sp|B0TBW5|RL27_HELMI 50S ribosomal protein L27 OS=Heliobacterium modesticaldum (strain ATCC 51547 / Ice1) GN=rpmA PE=3 SV=1 30 108 6.0E-07
sp|B3EUD7|RL27_AMOA5 50S ribosomal protein L27 OS=Amoebophilus asiaticus (strain 5a2) GN=rpmA PE=3 SV=1 39 106 6.0E-07
sp|P30155|RK27_TOBAC 50S ribosomal protein L27, chloroplastic OS=Nicotiana tabacum GN=RPL27 PE=1 SV=1 37 140 6.0E-07
sp|B7KFE2|RL27_CYAP7 50S ribosomal protein L27 OS=Cyanothece sp. (strain PCC 7424) GN=rpmA PE=3 SV=1 54 106 7.0E-07
sp|Q3ZYN4|RL27_DEHMC 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain CBDB1) GN=rpmA PE=3 SV=1 53 117 7.0E-07
sp|A5FQ13|RL27_DEHMB 50S ribosomal protein L27 OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=rpmA PE=3 SV=1 53 117 7.0E-07
sp|Q82V19|RL27_NITEU 50S ribosomal protein L27 OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=rpmA PE=3 SV=1 39 106 7.0E-07
sp|C4XNW1|RL27_DESMR 50S ribosomal protein L27 OS=Desulfovibrio magneticus (strain ATCC 700980 / DSM 13731 / RS-1) GN=rpmA PE=3 SV=1 39 106 7.0E-07
sp|A4IZ44|RL27_FRATW 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=rpmA PE=3 SV=1 39 107 7.0E-07
sp|Q5NGR1|RL27_FRATT 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=rpmA PE=3 SV=1 39 107 7.0E-07
sp|A0Q5Q3|RL27_FRATN 50S ribosomal protein L27 OS=Francisella tularensis subsp. novicida (strain U112) GN=rpmA PE=3 SV=1 39 107 7.0E-07
sp|B2SDE7|RL27_FRATM 50S ribosomal protein L27 OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=rpmA PE=3 SV=1 39 107 7.0E-07
sp|Q14I63|RL27_FRAT1 50S ribosomal protein L27 OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=rpmA PE=3 SV=1 39 107 7.0E-07
sp|Q88Q09|RL27_PSEPK 50S ribosomal protein L27 OS=Pseudomonas putida (strain KT2440) GN=rpmA PE=3 SV=1 53 122 7.0E-07
sp|B0KMF5|RL27_PSEPG 50S ribosomal protein L27 OS=Pseudomonas putida (strain GB-1) GN=rpmA PE=3 SV=1 53 122 7.0E-07
sp|A5VYC5|RL27_PSEP1 50S ribosomal protein L27 OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=rpmA PE=3 SV=1 53 122 7.0E-07
sp|Q1IF14|RL27_PSEE4 50S ribosomal protein L27 OS=Pseudomonas entomophila (strain L48) GN=rpmA PE=3 SV=1 53 122 7.0E-07
sp|Q9ABB3|RL27_CAUCR 50S ribosomal protein L27 OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=rpmA PE=3 SV=1 54 122 7.0E-07
sp|B8GYX1|RL27_CAUCN 50S ribosomal protein L27 OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=rpmA PE=3 SV=1 54 122 7.0E-07
sp|Q21Z00|RL27_RHOFT 50S ribosomal protein L27 OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=rpmA PE=3 SV=1 39 106 7.0E-07
sp|Q87SU3|RL27_VIBPA 50S ribosomal protein L27 OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=rpmA PE=3 SV=1 39 121 7.0E-07
sp|A7N0G1|RL27_VIBCB 50S ribosomal protein L27 OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=rpmA PE=3 SV=1 39 121 7.0E-07
sp|A1WPR6|RL27_VEREI 50S ribosomal protein L27 OS=Verminephrobacter eiseniae (strain EF01-2) GN=rpmA PE=3 SV=1 39 106 8.0E-07
sp|B4S9F0|RL27_PROA2 50S ribosomal protein L27 OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=rpmA PE=3 SV=1 39 106 8.0E-07
sp|B7VID4|RL27_VIBTL 50S ribosomal protein L27 OS=Vibrio tasmaniensis (strain LGP32) GN=rpmA PE=3 SV=1 39 121 8.0E-07
sp|B4RZH4|RL27_ALTMD 50S ribosomal protein L27 OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=rpmA1 PE=3 SV=1 39 121 8.0E-07
sp|B2SYV3|RL27_BURPP 50S ribosomal protein L27 OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=rpmA PE=3 SV=1 39 106 9.0E-07
sp|Q9ZMD8|RL27_HELPJ 50S ribosomal protein L27 OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|Q64XL7|RL27_BACFR 50S ribosomal protein L27 OS=Bacteroides fragilis (strain YCH46) GN=rpmA PE=3 SV=1 46 106 9.0E-07
sp|Q5LGR6|RL27_BACFN 50S ribosomal protein L27 OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=rpmA PE=3 SV=1 46 106 9.0E-07
sp|P56050|RL27_HELPY 50S ribosomal protein L27 OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|B2USC8|RL27_HELPS 50S ribosomal protein L27 OS=Helicobacter pylori (strain Shi470) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|Q1CUK6|RL27_HELPH 50S ribosomal protein L27 OS=Helicobacter pylori (strain HPAG1) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|B5ZA63|RL27_HELPG 50S ribosomal protein L27 OS=Helicobacter pylori (strain G27) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|B6JKM6|RL27_HELP2 50S ribosomal protein L27 OS=Helicobacter pylori (strain P12) GN=rpmA PE=3 SV=1 54 106 9.0E-07
sp|Q6LV48|RL27_PHOPR 50S ribosomal protein L27 OS=Photobacterium profundum GN=rpmA PE=3 SV=1 39 106 9.0E-07
sp|Q5R033|RL27_IDILO 50S ribosomal protein L27 OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|B3EEE4|RL27_CHLL2 50S ribosomal protein L27 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpmA PE=3 SV=1 39 106 1.0E-06
sp|Q3AF53|RL27_CARHZ 50S ribosomal protein L27 OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=rpmA PE=3 SV=1 53 108 1.0E-06
sp|C3LRG7|RL27_VIBCM 50S ribosomal protein L27 OS=Vibrio cholerae serotype O1 (strain M66-2) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|Q9KUS9|RL27_VIBCH 50S ribosomal protein L27 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|A5F8P1|RL27_VIBC3 50S ribosomal protein L27 OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|C0QT35|RL27_PERMH 50S ribosomal protein L27 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpmA PE=3 SV=1 39 106 1.0E-06
sp|A0LPF8|RL27_SYNFM 50S ribosomal protein L27 OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=rpmA PE=3 SV=1 39 109 1.0E-06
sp|B8D7S3|RL27_BUCAT 50S ribosomal protein L27 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|P57468|RL27_BUCAI 50S ribosomal protein L27 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|B8D9H1|RL27_BUCA5 50S ribosomal protein L27 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|C6DKH7|RL27_PECCP 50S ribosomal protein L27 OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|Q0VSE7|RL27_ALCBS 50S ribosomal protein L27 OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=rpmA PE=3 SV=1 53 106 1.0E-06
sp|B4SP13|RL27_STRM5 50S ribosomal protein L27 OS=Stenotrophomonas maltophilia (strain R551-3) GN=rpmA PE=3 SV=1 53 106 1.0E-06
sp|Q3B2R5|RL27_CHLL7 50S ribosomal protein L27 OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=rpmA PE=3 SV=1 39 106 1.0E-06
sp|Q057J1|RL27_BUCCC 50S ribosomal protein L27 OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=rpmA PE=3 SV=1 39 104 1.0E-06
sp|B6EL42|RL27_ALISL 50S ribosomal protein L27 OS=Aliivibrio salmonicida (strain LFI1238) GN=rpmA PE=3 SV=1 39 121 1.0E-06
sp|Q0AWJ2|RL27_SYNWW 50S ribosomal protein L27 OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=rpmA PE=3 SV=1 54 108 1.0E-06
sp|B2S3Y2|RL27_TREPS 50S ribosomal protein L27 OS=Treponema pallidum subsp. pallidum (strain SS14) GN=rpmA PE=3 SV=1 39 106 1.0E-06
sp|O83725|RL27_TREPA 50S ribosomal protein L27 OS=Treponema pallidum (strain Nichols) GN=rpmA PE=3 SV=1 39 106 1.0E-06
sp|B2FTD2|RL27_STRMK 50S ribosomal protein L27 OS=Stenotrophomonas maltophilia (strain K279a) GN=rpmA PE=3 SV=1 53 106 2.0E-06
sp|C5BFA2|RL27_EDWI9 50S ribosomal protein L27 OS=Edwardsiella ictaluri (strain 93-146) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|A8L1V7|RL27_FRASN 50S ribosomal protein L27 OS=Frankia sp. (strain EAN1pec) GN=rpmA PE=3 SV=1 54 108 2.0E-06
sp|B5FGF8|RL27_VIBFM 50S ribosomal protein L27 OS=Vibrio fischeri (strain MJ11) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|Q5E872|RL27_VIBF1 50S ribosomal protein L27 OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|A4G8R5|RL27_HERAR 50S ribosomal protein L27 OS=Herminiimonas arsenicoxydans GN=rpmA PE=3 SV=1 53 106 2.0E-06
sp|A1TYY3|RL27_MARHV 50S ribosomal protein L27 OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=rpmA PE=3 SV=1 53 121 2.0E-06
sp|Q11XX3|RL27_CYTH3 50S ribosomal protein L27 OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=rpmA PE=3 SV=1 54 108 2.0E-06
sp|A6TEK4|RL27_KLEP7 50S ribosomal protein L27 OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|B5XSV6|RL27_KLEP3 50S ribosomal protein L27 OS=Klebsiella pneumoniae (strain 342) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|P74267|RL27_SYNY3 50S ribosomal protein L27 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rpmA PE=3 SV=1 53 106 2.0E-06
sp|B0JQG5|RL27_MICAN 50S ribosomal protein L27 OS=Microcystis aeruginosa (strain NIES-843) GN=rpmA PE=3 SV=1 53 109 2.0E-06
sp|Q2JDP3|RL27_FRASC 50S ribosomal protein L27 OS=Frankia sp. (strain CcI3) GN=rpmA PE=3 SV=1 54 106 2.0E-06
sp|A5D408|RL27_PELTS 50S ribosomal protein L27 OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=rpmA PE=3 SV=1 53 108 2.0E-06
sp|Q7MYX5|RL27_PHOLL 50S ribosomal protein L27 OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|B4F2A7|RL27_PROMH 50S ribosomal protein L27 OS=Proteus mirabilis (strain HI4320) GN=rpmA PE=3 SV=1 39 121 2.0E-06
sp|Q0SR53|RL27_CLOPS 50S ribosomal protein L27 OS=Clostridium perfringens (strain SM101 / Type A) GN=rpmA PE=3 SV=1 53 108 2.0E-06
sp|Q8XIJ1|RL27_CLOPE 50S ribosomal protein L27 OS=Clostridium perfringens (strain 13 / Type A) GN=rpmA PE=3 SV=1 53 108 2.0E-06
sp|Q0TNI4|RL27_CLOP1 50S ribosomal protein L27 OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpmA PE=3 SV=1 53 108 2.0E-06
sp|A1KVV9|RL27_NEIMF 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|P66130|RL27_NEIMB 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup B (strain MC58) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|P66129|RL27_NEIMA 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|A9M2Z6|RL27_NEIM0 50S ribosomal protein L27 OS=Neisseria meningitidis serogroup C (strain 053442) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|Q8D278|RL27_WIGBR 50S ribosomal protein L27 OS=Wigglesworthia glossinidia brevipalpis GN=rpmA PE=3 SV=1 39 104 2.0E-06
sp|B3QZT2|RL27_PHYMT 50S ribosomal protein L27 OS=Phytoplasma mali (strain AT) GN=rpmA PE=3 SV=1 54 112 2.0E-06
sp|O21275|RM27_RECAM 60S ribosomal protein L27, mitochondrial OS=Reclinomonas americana GN=RPL27 PE=3 SV=1 37 112 2.0E-06
sp|B5YEQ2|RL27_DICT6 50S ribosomal protein L27 OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|A1BHN8|RL27_CHLPD 50S ribosomal protein L27 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpmA PE=3 SV=1 39 106 2.0E-06
sp|C3L3J4|RL27_CLOB6 50S ribosomal protein L27 OS=Clostridium botulinum (strain 657 / Type Ba4) GN=rpmA PE=3 SV=1 53 108 2.0E-06
sp|Q2L060|RL27_BORA1 50S ribosomal protein L27 OS=Bordetella avium (strain 197N) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|Q8KCB7|RL27_CHLTE 50S ribosomal protein L27 OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=rpmA PE=3 SV=1 39 116 3.0E-06
sp|A1W4A9|RL27_ACISJ 50S ribosomal protein L27 OS=Acidovorax sp. (strain JS42) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|B9MDZ6|RL27_ACIET 50S ribosomal protein L27 OS=Acidovorax ebreus (strain TPSY) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|Q0BL03|RL27_FRATO 50S ribosomal protein L27 OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=rpmA PE=3 SV=1 39 107 3.0E-06
sp|Q2A2E5|RL27_FRATH 50S ribosomal protein L27 OS=Francisella tularensis subsp. holarctica (strain LVS) GN=rpmA PE=3 SV=1 39 107 3.0E-06
sp|A7NDG1|RL27_FRATF 50S ribosomal protein L27 OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=rpmA PE=3 SV=1 39 107 3.0E-06
sp|B2VGT1|RL27_ERWT9 50S ribosomal protein L27 OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=rpmA PE=3 SV=1 39 121 3.0E-06
sp|P60493|RL27_THET8 50S ribosomal protein L27 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=rpmA PE=1 SV=3 53 106 3.0E-06
sp|Q0BZ41|RL27_HYPNA 50S ribosomal protein L27 OS=Hyphomonas neptunium (strain ATCC 15444) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|O87885|RL27_LAWIN 50S ribosomal protein L27 OS=Lawsonia intracellularis GN=rpmA PE=3 SV=1 57 106 3.0E-06
sp|Q2SS74|RL27_MYCCT 50S ribosomal protein L27 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=rpmA PE=3 SV=1 30 108 3.0E-06
sp|C1DEA5|RL27_AZOVD 50S ribosomal protein L27 OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=rpmA PE=3 SV=1 53 106 3.0E-06
sp|A5CVV8|RL27_VESOH 50S ribosomal protein L27 OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=rpmA PE=3 SV=1 39 108 3.0E-06
sp|Q6D9C5|RL27_PECAS 50S ribosomal protein L27 OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=rpmA PE=3 SV=1 39 121 3.0E-06
sp|Q72HR3|RL27_THET2 50S ribosomal protein L27 OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=rpmA PE=1 SV=3 53 106 3.0E-06
sp|A0Q1T6|RL27_CLONN 50S ribosomal protein L27 OS=Clostridium novyi (strain NT) GN=rpmA PE=3 SV=1 53 108 3.0E-06
sp|A4WEZ8|RL27_ENT38 50S ribosomal protein L27 OS=Enterobacter sp. (strain 638) GN=rpmA PE=3 SV=1 39 121 3.0E-06
sp|B4RNP1|RL27_NEIG2 50S ribosomal protein L27 OS=Neisseria gonorrhoeae (strain NCCP11945) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|Q5F685|RL27_NEIG1 50S ribosomal protein L27 OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=rpmA PE=3 SV=1 39 106 3.0E-06
sp|A7MJF4|RL27_CROS8 50S ribosomal protein L27 OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=rpmA PE=3 SV=1 39 121 3.0E-06
sp|A4VI53|RL27_PSEU5 50S ribosomal protein L27 OS=Pseudomonas stutzeri (strain A1501) GN=rpmA PE=3 SV=1 53 106 3.0E-06
sp|Q18B22|RL27_PEPD6 50S ribosomal protein L27 OS=Peptoclostridium difficile (strain 630) GN=rpmA PE=3 SV=1 36 121 4.0E-06
sp|Q15PE9|RL27_PSEA6 50S ribosomal protein L27 OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=rpmA PE=3 SV=1 39 121 4.0E-06
sp|Q6MT50|RL27_MYCMS 50S ribosomal protein L27 OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=rpmA PE=3 SV=1 30 108 4.0E-06
sp|B3QPY8|RL27_CHLP8 50S ribosomal protein L27 OS=Chlorobaculum parvum (strain NCIB 8327) GN=rpmA PE=3 SV=1 39 106 4.0E-06
sp|B2V0A7|RL27_CLOBA 50S ribosomal protein L27 OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=rpmA PE=3 SV=1 54 108 4.0E-06
sp|Q6F125|RL27_MESFL 50S ribosomal protein L27 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpmA PE=3 SV=1 30 108 4.0E-06
sp|B2TK69|RL27_CLOBB 50S ribosomal protein L27 OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=rpmA PE=3 SV=1 54 108 4.0E-06
sp|B1KZR4|RL27_CLOBM 50S ribosomal protein L27 OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|A7GHK3|RL27_CLOBL 50S ribosomal protein L27 OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|B1ILY6|RL27_CLOBK 50S ribosomal protein L27 OS=Clostridium botulinum (strain Okra / Type B1) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|C1FVW6|RL27_CLOBJ 50S ribosomal protein L27 OS=Clostridium botulinum (strain Kyoto / Type A2) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|A5I667|RL27_CLOBH 50S ribosomal protein L27 OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|A7FXU7|RL27_CLOB1 50S ribosomal protein L27 OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=rpmA PE=3 SV=1 53 108 4.0E-06
sp|A8AQ77|RL27_CITK8 50S ribosomal protein L27 OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=rpmA PE=3 SV=1 39 121 4.0E-06
sp|A1AXH4|RL27_RUTMC 50S ribosomal protein L27 OS=Ruthia magnifica subsp. Calyptogena magnifica GN=rpmA PE=3 SV=1 39 108 4.0E-06
sp|B8DVU0|RL27_BIFA0 50S ribosomal protein L27 OS=Bifidobacterium animalis subsp. lactis (strain AD011) GN=rpmA PE=3 SV=1 53 106 4.0E-06
sp|Q049M5|RL27_LACDB 50S ribosomal protein L27 OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=rpmA PE=3 SV=1 42 108 5.0E-06
sp|Q49Y83|RL27_STAS1 50S ribosomal protein L27 OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=rpmA PE=3 SV=1 31 108 5.0E-06
sp|A9IFF7|RL27_BORPD 50S ribosomal protein L27 OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=rpmA PE=3 SV=1 39 106 5.0E-06
sp|A7GTC2|RL27_BACCN 50S ribosomal protein L27 OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|B4U6N4|RL27_HYDS0 50S ribosomal protein L27 OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=rpmA PE=3 SV=1 39 106 5.0E-06
sp|C4K900|RL27_HAMD5 50S ribosomal protein L27 OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=rpmA PE=3 SV=1 39 106 5.0E-06
sp|Q817U4|RL27_BACCR 50S ribosomal protein L27 OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|B9IZ18|RL27_BACCQ 50S ribosomal protein L27 OS=Bacillus cereus (strain Q1) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|B7HQK0|RL27_BACC7 50S ribosomal protein L27 OS=Bacillus cereus (strain AH187) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|B7HE75|RL27_BACC4 50S ribosomal protein L27 OS=Bacillus cereus (strain B4264) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|Q72ZY3|RL27_BACC1 50S ribosomal protein L27 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=rpmA PE=3 SV=1 35 108 5.0E-06
sp|A5VD71|RL27_SPHWW 50S ribosomal protein L27 OS=Sphingomonas wittichii (strain RW1 / DSM 6014 / JCM 10273) GN=rpmA PE=3 SV=1 39 121 6.0E-06
sp|Q5WES5|RL27_BACSK 50S ribosomal protein L27 OS=Bacillus clausii (strain KSM-K16) GN=rpmA PE=3 SV=1 35 108 6.0E-06
sp|Q3K6K8|RL27_PSEPF 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain Pf0-1) GN=rpmA PE=3 SV=1 53 106 6.0E-06
sp|Q4K5T7|RL27_PSEF5 50S ribosomal protein L27 OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=rpmA PE=3 SV=1 53 106 6.0E-06
sp|A4SR18|RL27_AERS4 50S ribosomal protein L27 OS=Aeromonas salmonicida (strain A449) GN=rpmA PE=3 SV=1 39 121 6.0E-06
sp|A4SFT3|RL27_CHLPM 50S ribosomal protein L27 OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=rpmA PE=3 SV=1 39 106 6.0E-06
sp|B8I178|RL27_CLOCE 50S ribosomal protein L27 OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=rpmA PE=3 SV=1 54 108 6.0E-06
sp|B3PIU8|RL27_CELJU 50S ribosomal protein L27 OS=Cellvibrio japonicus (strain Ueda107) GN=rpmA PE=3 SV=1 54 106 6.0E-06
sp|A9B129|RL27_HERA2 50S ribosomal protein L27 OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=rpmA PE=3 SV=1 53 106 7.0E-06
sp|A6T2D6|RL27_JANMA 50S ribosomal protein L27 OS=Janthinobacterium sp. (strain Marseille) GN=rpmA PE=3 SV=1 53 106 7.0E-06
sp|Q87BL1|RL27_XYLFT 50S ribosomal protein L27 OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rpmA PE=3 SV=1 53 106 7.0E-06
sp|B0U3R4|RL27_XYLFM 50S ribosomal protein L27 OS=Xylella fastidiosa (strain M12) GN=rpmA PE=3 SV=1 53 106 7.0E-06
sp|B2I6V7|RL27_XYLF2 50S ribosomal protein L27 OS=Xylella fastidiosa (strain M23) GN=rpmA PE=3 SV=1 53 106 7.0E-06
sp|P66134|RL27_STAAW 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MW2) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|A8Z2H3|RL27_STAAT 50S ribosomal protein L27 OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|Q6G8S4|RL27_STAAS 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MSSA476) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|Q6GG59|RL27_STAAR 50S ribosomal protein L27 OS=Staphylococcus aureus (strain MRSA252) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|P66133|RL27_STAAN 50S ribosomal protein L27 OS=Staphylococcus aureus (strain N315) GN=rpmA PE=1 SV=1 31 108 7.0E-06
sp|Q931Q3|RL27_STAAM 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=rpmA PE=3 SV=3 31 108 7.0E-06
sp|A6QHI7|RL27_STAAE 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Newman) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|Q5HFB8|RL27_STAAC 50S ribosomal protein L27 OS=Staphylococcus aureus (strain COL) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|Q2YT85|RL27_STAAB 50S ribosomal protein L27 OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|A5ITG9|RL27_STAA9 50S ribosomal protein L27 OS=Staphylococcus aureus (strain JH9) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|Q2FXT0|RL27_STAA8 50S ribosomal protein L27 OS=Staphylococcus aureus (strain NCTC 8325) GN=rpmA PE=1 SV=1 31 108 7.0E-06
sp|Q2FG82|RL27_STAA3 50S ribosomal protein L27 OS=Staphylococcus aureus (strain USA300) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|A6U2B3|RL27_STAA2 50S ribosomal protein L27 OS=Staphylococcus aureus (strain JH1) GN=rpmA PE=3 SV=1 31 108 7.0E-06
sp|A7X362|RL27_STAA1 50S ribosomal protein L27 OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=rpmA PE=3 SV=1 31 108 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0005840 ribosome Yes
GO:0006412 translation Yes
GO:0008152 metabolic process No
GO:0043228 non-membrane-bounded organelle No
GO:0043603 cellular amide metabolic process No
GO:0043229 intracellular organelle No
GO:0009059 macromolecule biosynthetic process No
GO:1901576 organic substance biosynthetic process No
GO:0005198 structural molecule activity No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0044238 primary metabolic process No
GO:0043226 organelle No
GO:0019538 protein metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0005575 cellular_component No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0006518 peptide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0043604 amide biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0110165 cellular anatomical entity No
GO:0044260 cellular macromolecule metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0043043 peptide biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1149
MQLLTIRPAPGAVFAPVLRAWSAPRLPGAVLQVRYASVKTQGAYKKQPKRGIPKKLGAKRTGGKYQYVIPGNIIY
KQRGSVWHPGENCMMGRTHTIHAMVPGYVKYYRDPDKHPRRKYIGVTLRREDSLPYPKNAQRRRRLGMAEHRIKP
PRHPYMKHYTASLSRNDELFDVGVRPLTKEQLLAKQPLSPSGIPWQIVRKVDGEPDRVLRLRDDYSYKEDNWRLG
KLVKTAHVQTKQFRSRKKFFRHRRWRRDRECKFEHARAAALAAREPLEKYVVVKKKKATRKEKKMAKRSAKKENK
MRKKAGL*
Coding >OphauG2|1149
ATGCAGCTCCTGACAATTCGGCCAGCTCCAGGGGCCGTGTTTGCGCCAGTGCTGCGTGCGTGGTCAGCGCCTCGA
CTGCCTGGAGCCGTGCTGCAGGTTCGCTATGCCTCTGTCAAGACGCAGGGAGCGTACAAGAAGCAGCCCAAGCGA
GGAATCCCCAAGAAGCTGGGAGCCAAGCGCACAGGCGGCAAGTATCAATATGTGATTCCTGGCAACATCATCTAT
AAACAACGTGGCTCAGTTTGGCATCCTGGCGAAAACTGCATGATGGGCCGCACGCACACGATTCACGCCATGGTT
CCGGGCTACGTGAAATACTACCGTGACCCCGACAAGCACCCGCGACGCAAGTACATTGGAGTGACGCTTAGACGA
GAGGACAGTCTGCCCTACCCCAAAAACGCCCAGCGCCGACGCCGCCTAGGCATGGCAGAGCACCGCATCAAGCCG
CCCAGACACCCATACATGAAGCATTACACCGCATCCCTCTCCCGCAACGACGAGCTCTTCGACGTTGGCGTGCGG
CCCCTGACCAAGGAGCAATTACTAGCCAAGCAACCCCTCTCCCCATCTGGAATCCCATGGCAAATCGTCCGCAAG
GTAGACGGCGAGCCAGACCGCGTGCTACGACTGCGCGACGACTATAGCTACAAGGAAGATAACTGGCGGCTGGGA
AAGCTGGTCAAGACGGCACACGTGCAGACGAAGCAGTTTAGGTCTCGAAAGAAGTTTTTTAGACATCGGAGATGG
AGGCGCGATAGAGAGTGCAAGTTTGAGCATGCTCGGGCTGCGGCGCTAGCGGCAAGGGAGCCATTGGAGAAGTAT
GTGGTGGTGAAGAAGAAGAAGGCTACGAGGAAGGAGAAAAAGATGGCCAAGAGGAGTGCCAAGAAGGAGAATAAG
ATGAGGAAGAAGGCTGGACTTTAG
Transcript >OphauG2|1149
ATGCAGCTCCTGACAATTCGGCCAGCTCCAGGGGCCGTGTTTGCGCCAGTGCTGCGTGCGTGGTCAGCGCCTCGA
CTGCCTGGAGCCGTGCTGCAGGTTCGCTATGCCTCTGTCAAGACGCAGGGAGCGTACAAGAAGCAGCCCAAGCGA
GGAATCCCCAAGAAGCTGGGAGCCAAGCGCACAGGCGGCAAGTATCAATATGTGATTCCTGGCAACATCATCTAT
AAACAACGTGGCTCAGTTTGGCATCCTGGCGAAAACTGCATGATGGGCCGCACGCACACGATTCACGCCATGGTT
CCGGGCTACGTGAAATACTACCGTGACCCCGACAAGCACCCGCGACGCAAGTACATTGGAGTGACGCTTAGACGA
GAGGACAGTCTGCCCTACCCCAAAAACGCCCAGCGCCGACGCCGCCTAGGCATGGCAGAGCACCGCATCAAGCCG
CCCAGACACCCATACATGAAGCATTACACCGCATCCCTCTCCCGCAACGACGAGCTCTTCGACGTTGGCGTGCGG
CCCCTGACCAAGGAGCAATTACTAGCCAAGCAACCCCTCTCCCCATCTGGAATCCCATGGCAAATCGTCCGCAAG
GTAGACGGCGAGCCAGACCGCGTGCTACGACTGCGCGACGACTATAGCTACAAGGAAGATAACTGGCGGCTGGGA
AAGCTGGTCAAGACGGCACACGTGCAGACGAAGCAGTTTAGGTCTCGAAAGAAGTTTTTTAGACATCGGAGATGG
AGGCGCGATAGAGAGTGCAAGTTTGAGCATGCTCGGGCTGCGGCGCTAGCGGCAAGGGAGCCATTGGAGAAGTAT
GTGGTGGTGAAGAAGAAGAAGGCTACGAGGAAGGAGAAAAAGATGGCCAAGAGGAGTGCCAAGAAGGAGAATAAG
ATGAGGAAGAAGGCTGGACTTTAG
Gene >OphauG2|1149
ATGCAGCTCCTGACAATTCGGCCAGCTCCAGGGGCCGTGTTTGCGCCAGTGCTGCGTGCGTGGTCAGCGCCTCGA
CTGCCTGGAGCCGTGCTGCAGGTTCGCTATGCCTCTGTCAAGACGCAGGGAGCGTACAAGAAGCAGCCCAAGCGA
GGAATCCCCAAGAAGCTGGGAGCCAAGCGCACAGGCGGCAAGTGTCTCTTGGCCTTCTCCATCCCCTCCCCTTTT
TCTTTTGCCCATTGTTGCCAGAAAACAAAAATGTCTGCTCGCGCCGCTGCATGTCTGACCAAGAGCAGATCAATA
TGTGATTCCTGGCAACATCATCTATAAACAACGTGGCTCAGTTTGGCATCCTGGCGAAAACTGCATGATGGGCCG
CACGCACACGATTCACGCCATGGTTCCGGGCTACGTGAAATACTACCGTGACCCCGACAAGCACCCGCGACGCAA
GTACATTGGAGTGACGCTTAGACGAGAGGACAGTCTGCCCTACCCCAAAAACGCCCAGCGCCGACGCCGCCTAGG
CATGGCAGAGCACCGCATCAAGCCGCCCAGACACCCATACATGAAGCATTACACCGCATCCCTCTCCCGCAACGA
CGAGCTCTTCGACGTTGGCGTGCGGCCCCTGACCAAGGAGCAATTACTAGCCAAGCAACCCCTCTCCCCATCTGG
AATCCCATGGCAAATCGTCCGCAAGGTAGACGGCGAGCCAGACCGCGTGCTACGACTGCGCGACGACTATAGCTA
CAAGGAAGATAACTGGCGGCTGGGAAAGCTGGTCAAGACGGCACACGTGCAGACGAAGCAGTTTAGGTCTCGAAA
GAAGTTTTTTAGACATCGGAGATGGAGGCGCGATAGAGAGTGCAAGTTTGAGCATGCTCGGGCTGCGGCGCTAGC
GGCAAGGGAGCCATTGGAGAAGTATGTGGTGGTGAAGAAGAAGAAGGCTACGAGGAAGGAGAAAAAGATGGCCAA
GAGGAGTGCCAAGAAGGAGAATAAGATGAGGAAGAAGGCTGGACTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail