Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1145
Gene name
LocationContig_132:19879..20423
Strand+
Gene length (bp)544
Transcript length (bp)366
Coding sequence length (bp)366
Protein length (aa) 122

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 5.4E-12 24 87

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 21 114 5.0E-22
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 25 112 5.0E-16
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 33 114 4.0E-14
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 1 119 2.0E-13
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 10 115 4.0E-13
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9SK39|SBP3_ARATH Probable steroid-binding protein 3 OS=Arabidopsis thaliana GN=MP3 PE=1 SV=1 21 114 5.0E-22
sp|O13995|DAP1_SCHPO Cytochrome P450 regulator dap1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dap1 PE=1 SV=1 25 112 5.0E-16
sp|Q60YT6|NEUFC_CAEBR Neuferricin homolog OS=Caenorhabditis briggsae GN=tag-131 PE=3 SV=1 33 114 4.0E-14
sp|Q9XFM6|MSBP1_ARATH Membrane steroid-binding protein 1 OS=Arabidopsis thaliana GN=MSBP1 PE=1 SV=2 1 119 2.0E-13
sp|Q9M2Z4|MSBP2_ARATH Membrane steroid-binding protein 2 OS=Arabidopsis thaliana GN=MSBP2 PE=1 SV=1 10 115 4.0E-13
sp|Q5RED0|PGRC1_PONAB Membrane-associated progesterone receptor component 1 OS=Pongo abelii GN=PGRMC1 PE=2 SV=3 25 112 7.0E-13
sp|Q95250|PGRC1_PIG Membrane-associated progesterone receptor component 1 OS=Sus scrofa GN=PGRMC1 PE=1 SV=3 25 112 7.0E-13
sp|O00264|PGRC1_HUMAN Membrane-associated progesterone receptor component 1 OS=Homo sapiens GN=PGRMC1 PE=1 SV=3 25 112 7.0E-13
sp|P70580|PGRC1_RAT Membrane-associated progesterone receptor component 1 OS=Rattus norvegicus GN=Pgrmc1 PE=1 SV=3 25 112 8.0E-13
sp|Q17QC0|PGRC1_BOVIN Membrane-associated progesterone receptor component 1 OS=Bos taurus GN=PGRMC1 PE=2 SV=3 25 112 9.0E-13
sp|O55022|PGRC1_MOUSE Membrane-associated progesterone receptor component 1 OS=Mus musculus GN=Pgrmc1 PE=1 SV=4 25 112 1.0E-12
sp|Q5ZKN2|PGRC1_CHICK Membrane-associated progesterone receptor component 1 OS=Gallus gallus GN=PGRMC1 PE=2 SV=3 17 112 3.0E-12
sp|Q9XXA7|NEUFC_CAEEL Neuferricin homolog OS=Caenorhabditis elegans GN=tag-131 PE=3 SV=1 33 114 3.0E-12
sp|Q12091|DAP1_YEAST Damage response protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAP1 PE=1 SV=1 26 114 4.0E-12
sp|A2CES0|NEUFC_DANRE Neuferricin OS=Danio rerio GN=cyb5d2 PE=3 SV=1 21 121 7.0E-12
sp|Q8WUJ1|NEUFC_HUMAN Neuferricin OS=Homo sapiens GN=CYB5D2 PE=2 SV=1 24 116 1.0E-11
sp|Q28FI8|NEUFC_XENTR Neuferricin OS=Xenopus tropicalis GN=cyb5d2 PE=2 SV=1 9 116 4.0E-11
sp|Q6AY62|NEUFC_RAT Neuferricin OS=Rattus norvegicus GN=Cyb5d2 PE=2 SV=1 24 116 1.0E-10
sp|O15173|PGRC2_HUMAN Membrane-associated progesterone receptor component 2 OS=Homo sapiens GN=PGRMC2 PE=1 SV=1 17 114 1.0E-10
sp|Q5XIU9|PGRC2_RAT Membrane-associated progesterone receptor component 2 OS=Rattus norvegicus GN=Pgrmc2 PE=1 SV=1 17 112 1.0E-10
sp|Q80UU9|PGRC2_MOUSE Membrane-associated progesterone receptor component 2 OS=Mus musculus GN=Pgrmc2 PE=1 SV=2 17 112 1.0E-10
sp|Q5SSH8|NEUFC_MOUSE Neuferricin OS=Mus musculus GN=Cyb5d2 PE=1 SV=1 24 116 2.0E-10
sp|Q6IUR5|NENF_RAT Neudesin OS=Rattus norvegicus GN=Nenf PE=2 SV=1 24 112 1.0E-08
sp|Q9CQ45|NENF_MOUSE Neudesin OS=Mus musculus GN=Nenf PE=1 SV=1 24 112 4.0E-08
sp|Q2HIW2|MAPR4_ARATH Membrane-associated progesterone-binding protein 4 OS=Arabidopsis thaliana GN=MAPR4 PE=2 SV=1 21 116 5.0E-08
sp|Q1JQA5|NENF_BOVIN Neudesin OS=Bos taurus GN=NENF PE=2 SV=1 2 112 1.0E-07
sp|Q9UMX5|NENF_HUMAN Neudesin OS=Homo sapiens GN=NENF PE=1 SV=1 10 112 2.0E-07
sp|Q29HF1|NEUFC_DROPS Neuferricin homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA11364 PE=3 SV=1 21 116 3.0E-07
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2516
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1145 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7220
Ophiocordyceps camponoti-floridani Ophcf2|05484
Ophiocordyceps camponoti-rufipedis Ophun1|4989
Ophiocordyceps kimflemingae Ophio5|7057
Ophiocordyceps subramaniannii Hirsu2|3678

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1145
MAGKFEPKVPVQLDPPKNDPISIDELAKANGVDGAKCYVAIKGKVYDVTGNKAYQPGGSYHVFAGKDASRALGKT
STKPEHVGPDWHDLEDKEKGVLDDWVTFFSKRYNVVGVVEGAANME*
Coding >OphauG2|1145
ATGGCTGGCAAGTTTGAACCCAAAGTGCCTGTCCAGCTTGACCCTCCCAAGAATGACCCCATCTCGATCGATGAG
CTGGCCAAGGCCAACGGCGTTGACGGTGCCAAGTGCTATGTGGCCATCAAGGGCAAAGTCTACGACGTGACTGGC
AACAAGGCCTACCAGCCCGGAGGCTCGTACCATGTCTTTGCGGGCAAGGATGCGTCTCGCGCCCTGGGGAAAACG
TCTACCAAGCCCGAGCATGTCGGGCCGGACTGGCACGACCTGGAGGACAAGGAAAAGGGCGTCCTCGACGACTGG
GTCACCTTTTTCTCCAAGCGCTACAATGTGGTGGGAGTTGTCGAGGGCGCGGCCAACATGGAATGA
Transcript >OphauG2|1145
ATGGCTGGCAAGTTTGAACCCAAAGTGCCTGTCCAGCTTGACCCTCCCAAGAATGACCCCATCTCGATCGATGAG
CTGGCCAAGGCCAACGGCGTTGACGGTGCCAAGTGCTATGTGGCCATCAAGGGCAAAGTCTACGACGTGACTGGC
AACAAGGCCTACCAGCCCGGAGGCTCGTACCATGTCTTTGCGGGCAAGGATGCGTCTCGCGCCCTGGGGAAAACG
TCTACCAAGCCCGAGCATGTCGGGCCGGACTGGCACGACCTGGAGGACAAGGAAAAGGGCGTCCTCGACGACTGG
GTCACCTTTTTCTCCAAGCGCTACAATGTGGTGGGAGTTGTCGAGGGCGCGGCCAACATGGAATGA
Gene >OphauG2|1145
ATGGCTGGCAAGTTTGAACCCAAAGTGCCTGTCCAGCTTGACCCTCCCAAGAATGACCCCATCTCGATCGATGAG
CTGGCCAAGGCCAACGGTACATGCGTCTCGCGCCATGCCCGTCTTTTTCTCCTCGCTAATGGCTGCTGGACGTGA
CAGGCGTTGACGGTGCCAAGTGCTATGTGGCCATCAAGGTGAGTCTCTCTGCCGCAGAACTGGGCCGTAGGCTGC
TCAAGCAGCTGTTATCCAAGGGCAAAGTCTACGACGTGACTGGCAACAAGGCCTACCAGCCCGGAGGCTCGTACC
ATGGTGTGCAACAGCCGGCCCTCATGTCGAGCGGCGACAAAAGGCTAAAACTATGGCTTTAGTCTTTGCGGGCAA
GGATGCGTCTCGCGCCCTGGGGAAAACGTCTACCAAGCCCGAGCATGTCGGGCCGGACTGGCACGACCTGGAGGA
CAAGGAAAAGGGCGTCCTCGACGACTGGGTCACCTTTTTCTCCAAGCGCTACAATGTGGTGGGAGTTGTCGAGGG
CGCGGCCAACATGGAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail