Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1141
Gene name
LocationContig_132:8246..9440
Strand-
Gene length (bp)1194
Transcript length (bp)1194
Coding sequence length (bp)1194
Protein length (aa) 398

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 1.1E-10 208 265

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 18 265 4.0E-39
sp|Q09100|RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnp24 PE=3 SV=2 9 254 2.0E-36
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 138 264 1.0E-11
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 138 265 6.0E-10
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 138 265 7.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53883|NOP13_YEAST Nucleolar protein 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP13 PE=1 SV=2 18 265 4.0E-39
sp|Q09100|RNP24_SCHPO RNA-binding protein rnp24 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rnp24 PE=3 SV=2 9 254 2.0E-36
sp|P41891|GAR2_SCHPO Protein gar2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gar2 PE=1 SV=2 138 264 1.0E-11
sp|Q5RC80|RBM39_PONAB RNA-binding protein 39 OS=Pongo abelii GN=RBM39 PE=2 SV=1 138 265 6.0E-10
sp|Q8VH51|RBM39_MOUSE RNA-binding protein 39 OS=Mus musculus GN=Rbm39 PE=1 SV=2 138 265 7.0E-10
sp|Q14498|RBM39_HUMAN RNA-binding protein 39 OS=Homo sapiens GN=RBM39 PE=1 SV=2 138 265 7.0E-10
sp|Q5M9F1|RBM34_RAT RNA-binding protein 34 OS=Rattus norvegicus GN=Rbm34 PE=1 SV=1 44 265 2.0E-09
sp|Q8C5L7|RBM34_MOUSE RNA-binding protein 34 OS=Mus musculus GN=Rbm34 PE=1 SV=1 74 265 5.0E-09
sp|Q86U06|RBM23_HUMAN Probable RNA-binding protein 23 OS=Homo sapiens GN=RBM23 PE=1 SV=1 138 265 8.0E-09
sp|P42696|RBM34_HUMAN RNA-binding protein 34 OS=Homo sapiens GN=RBM34 PE=1 SV=2 51 265 8.0E-09
sp|Q9ZQA8|PABP7_ARATH Polyadenylate-binding protein 7 OS=Arabidopsis thaliana GN=PAB7 PE=2 SV=1 206 267 3.0E-08
sp|P27476|NSR1_YEAST Nuclear localization sequence-binding protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NSR1 PE=1 SV=1 86 264 1.0E-07
sp|Q9Y4C8|RBM19_HUMAN Probable RNA-binding protein 19 OS=Homo sapiens GN=RBM19 PE=1 SV=3 75 270 4.0E-07
sp|Q1PEP5|NUCL2_ARATH Nucleolin 2 OS=Arabidopsis thaliana GN=NUCL2 PE=2 SV=1 204 264 7.0E-07
sp|Q7XTT4|NUCL2_ORYSJ Nucleolin 2 OS=Oryza sativa subsp. japonica GN=Os04g0620700 PE=2 SV=2 202 264 1.0E-06
sp|Q9FJN9|PABN2_ARATH Polyadenylate-binding protein 2 OS=Arabidopsis thaliana GN=PABN2 PE=1 SV=1 183 265 2.0E-06
sp|Q08208|NOP12_YEAST Nucleolar protein 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NOP12 PE=1 SV=1 208 264 2.0E-06
sp|Q75A83|MRD1_ASHGO Multiple RNA-binding domain-containing protein 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MRD1 PE=3 SV=2 199 263 2.0E-06
sp|Q9WX37|RBPE_NOSS1 Putative RNA-binding protein RbpE OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=rbpE PE=3 SV=3 208 259 5.0E-06
sp|Q6IQE0|PU60B_DANRE Poly(U)-binding-splicing factor PUF60-B OS=Danio rerio GN=puf60b PE=2 SV=2 138 264 6.0E-06
sp|Q93VI4|PABN1_ARATH Polyadenylate-binding protein 1 OS=Arabidopsis thaliana GN=PABN1 PE=1 SV=1 183 260 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No
GO:0003676 nucleic acid binding No
GO:0097159 organic cyclic compound binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 50 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1141
MADKQRDSAEPDTATQAPSTKRKAVVQEIQVDLSAPEPPSKKARRALKKGKSLDAKKRDSDDDDDDSQRYDQDDA
DKSRPPSEHGVWIGNLPFTVTAPDLRKWLVDNSGGVITNESITRIKMPMSKIAAQDKSQKPTNKGFAYIDFEDIS
HKLAAAALTEAPFGGRQLLIKDSKSFEGRPAKATEQASGAVGSNGKLQVSDARGSSKIFVGNMSFKATQEDLTRH
FEKCGEIKWVKLATFEDSGKCKGYGWVTFKEPEAAAWAVKGFVKVKEEIETDKDFDHDLDESQDGAQRKKFKMRK
WWVNRLLGRELKIELAEDDQTRYKKRFGKGGSNRQGIEKPIHDENHITNRGDNEDAEQSQQIREATRPAVHKGHD
IDIARRTGGLVKPTGTKATFDD*
Coding >OphauG2|1141
ATGGCTGACAAACAAAGAGACTCGGCTGAGCCCGACACTGCCACGCAGGCGCCATCGACAAAACGCAAGGCTGTC
GTGCAAGAGATCCAAGTCGACTTGTCCGCCCCAGAACCTCCGTCCAAGAAAGCCCGGCGCGCATTAAAAAAGGGC
AAATCGCTTGATGCCAAAAAGCGAGACAGCGACGACGACGATGACGACTCCCAACGATATGATCAAGACGATGCA
GACAAATCCAGGCCCCCATCAGAACATGGCGTCTGGATCGGAAACTTGCCATTCACCGTGACTGCTCCTGACCTT
CGGAAATGGCTTGTCGATAATTCCGGAGGTGTCATCACGAACGAGTCAATAACGCGCATCAAAATGCCCATGTCA
AAAATTGCTGCTCAAGACAAGAGCCAGAAGCCTACCAATAAGGGCTTTGCCTATATCGACTTTGAGGACATCAGC
CACAAGCTTGCCGCTGCAGCCCTGACAGAAGCGCCCTTTGGAGGCCGACAGCTTCTAATCAAGGACTCCAAGTCT
TTCGAGGGTCGGCCAGCAAAAGCAACCGAGCAAGCAAGTGGTGCCGTGGGCTCTAATGGCAAATTACAAGTCAGC
GATGCGCGTGGTAGTTCCAAGATTTTTGTCGGCAATATGAGCTTCAAAGCTACCCAGGAAGACTTGACTCGACAC
TTTGAAAAGTGTGGAGAAATAAAATGGGTAAAACTGGCTACCTTTGAGGACTCTGGAAAATGCAAAGGCTACGGC
TGGGTAACATTCAAGGAGCCAGAAGCTGCAGCGTGGGCTGTCAAGGGTTTCGTCAAAGTTAAAGAGGAAATCGAA
ACAGACAAAGATTTTGACCATGACCTAGATGAAAGTCAAGATGGAGCTCAGAGGAAAAAGTTCAAGATGAGGAAA
TGGTGGGTCAATAGACTGCTGGGAAGGGAGCTTAAAATCGAATTGGCCGAGGACGACCAGACACGATACAAGAAG
AGGTTTGGCAAGGGGGGCAGCAATCGACAAGGCATAGAAAAGCCGATTCACGATGAGAACCACATTACAAATCGA
GGCGATAATGAAGATGCCGAGCAATCGCAGCAGATAAGGGAGGCGACGAGGCCAGCCGTTCACAAAGGACATGAC
ATAGATATCGCCAGACGAACCGGTGGGCTTGTAAAACCCACCGGCACCAAGGCTACCTTTGACGACTAG
Transcript >OphauG2|1141
ATGGCTGACAAACAAAGAGACTCGGCTGAGCCCGACACTGCCACGCAGGCGCCATCGACAAAACGCAAGGCTGTC
GTGCAAGAGATCCAAGTCGACTTGTCCGCCCCAGAACCTCCGTCCAAGAAAGCCCGGCGCGCATTAAAAAAGGGC
AAATCGCTTGATGCCAAAAAGCGAGACAGCGACGACGACGATGACGACTCCCAACGATATGATCAAGACGATGCA
GACAAATCCAGGCCCCCATCAGAACATGGCGTCTGGATCGGAAACTTGCCATTCACCGTGACTGCTCCTGACCTT
CGGAAATGGCTTGTCGATAATTCCGGAGGTGTCATCACGAACGAGTCAATAACGCGCATCAAAATGCCCATGTCA
AAAATTGCTGCTCAAGACAAGAGCCAGAAGCCTACCAATAAGGGCTTTGCCTATATCGACTTTGAGGACATCAGC
CACAAGCTTGCCGCTGCAGCCCTGACAGAAGCGCCCTTTGGAGGCCGACAGCTTCTAATCAAGGACTCCAAGTCT
TTCGAGGGTCGGCCAGCAAAAGCAACCGAGCAAGCAAGTGGTGCCGTGGGCTCTAATGGCAAATTACAAGTCAGC
GATGCGCGTGGTAGTTCCAAGATTTTTGTCGGCAATATGAGCTTCAAAGCTACCCAGGAAGACTTGACTCGACAC
TTTGAAAAGTGTGGAGAAATAAAATGGGTAAAACTGGCTACCTTTGAGGACTCTGGAAAATGCAAAGGCTACGGC
TGGGTAACATTCAAGGAGCCAGAAGCTGCAGCGTGGGCTGTCAAGGGTTTCGTCAAAGTTAAAGAGGAAATCGAA
ACAGACAAAGATTTTGACCATGACCTAGATGAAAGTCAAGATGGAGCTCAGAGGAAAAAGTTCAAGATGAGGAAA
TGGTGGGTCAATAGACTGCTGGGAAGGGAGCTTAAAATCGAATTGGCCGAGGACGACCAGACACGATACAAGAAG
AGGTTTGGCAAGGGGGGCAGCAATCGACAAGGCATAGAAAAGCCGATTCACGATGAGAACCACATTACAAATCGA
GGCGATAATGAAGATGCCGAGCAATCGCAGCAGATAAGGGAGGCGACGAGGCCAGCCGTTCACAAAGGACATGAC
ATAGATATCGCCAGACGAACCGGTGGGCTTGTAAAACCCACCGGCACCAAGGCTACCTTTGACGACTAG
Gene >OphauG2|1141
ATGGCTGACAAACAAAGAGACTCGGCTGAGCCCGACACTGCCACGCAGGCGCCATCGACAAAACGCAAGGCTGTC
GTGCAAGAGATCCAAGTCGACTTGTCCGCCCCAGAACCTCCGTCCAAGAAAGCCCGGCGCGCATTAAAAAAGGGC
AAATCGCTTGATGCCAAAAAGCGAGACAGCGACGACGACGATGACGACTCCCAACGATATGATCAAGACGATGCA
GACAAATCCAGGCCCCCATCAGAACATGGCGTCTGGATCGGAAACTTGCCATTCACCGTGACTGCTCCTGACCTT
CGGAAATGGCTTGTCGATAATTCCGGAGGTGTCATCACGAACGAGTCAATAACGCGCATCAAAATGCCCATGTCA
AAAATTGCTGCTCAAGACAAGAGCCAGAAGCCTACCAATAAGGGCTTTGCCTATATCGACTTTGAGGACATCAGC
CACAAGCTTGCCGCTGCAGCCCTGACAGAAGCGCCCTTTGGAGGCCGACAGCTTCTAATCAAGGACTCCAAGTCT
TTCGAGGGTCGGCCAGCAAAAGCAACCGAGCAAGCAAGTGGTGCCGTGGGCTCTAATGGCAAATTACAAGTCAGC
GATGCGCGTGGTAGTTCCAAGATTTTTGTCGGCAATATGAGCTTCAAAGCTACCCAGGAAGACTTGACTCGACAC
TTTGAAAAGTGTGGAGAAATAAAATGGGTAAAACTGGCTACCTTTGAGGACTCTGGAAAATGCAAAGGCTACGGC
TGGGTAACATTCAAGGAGCCAGAAGCTGCAGCGTGGGCTGTCAAGGGTTTCGTCAAAGTTAAAGAGGAAATCGAA
ACAGACAAAGATTTTGACCATGACCTAGATGAAAGTCAAGATGGAGCTCAGAGGAAAAAGTTCAAGATGAGGAAA
TGGTGGGTCAATAGACTGCTGGGAAGGGAGCTTAAAATCGAATTGGCCGAGGACGACCAGACACGATACAAGAAG
AGGTTTGGCAAGGGGGGCAGCAATCGACAAGGCATAGAAAAGCCGATTCACGATGAGAACCACATTACAAATCGA
GGCGATAATGAAGATGCCGAGCAATCGCAGCAGATAAGGGAGGCGACGAGGCCAGCCGTTCACAAAGGACATGAC
ATAGATATCGCCAGACGAACCGGTGGGCTTGTAAAACCCACCGGCACCAAGGCTACCTTTGACGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail