Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1132
Gene name
LocationContig_1314:4034..4421
Strand-
Gene length (bp)387
Transcript length (bp)387
Coding sequence length (bp)387
Protein length (aa) 129

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14938 SNAP Soluble NSF attachment protein, SNAP 1.9E-45 2 119

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6A5|SEC17_NEUCR Probable vesicular-fusion protein sec17 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1D1.150 PE=3 SV=1 1 128 7.0E-36
sp|Q9P4X4|SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec17 PE=1 SV=1 1 119 2.0E-31
sp|Q9M5P8|SNAA_SOLTU Alpha-soluble NSF attachment protein OS=Solanum tuberosum PE=2 SV=1 1 120 8.0E-29
sp|Q9SPE6|SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana GN=ASNAP2 PE=1 SV=1 8 120 1.0E-26
sp|P93798|SNAA_VITVI Alpha-soluble NSF attachment protein OS=Vitis vinifera PE=2 SV=1 1 120 2.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9P6A5|SEC17_NEUCR Probable vesicular-fusion protein sec17 homolog OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B1D1.150 PE=3 SV=1 1 128 7.0E-36
sp|Q9P4X4|SEC17_SCHPO Probable vesicular-fusion protein sec17 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec17 PE=1 SV=1 1 119 2.0E-31
sp|Q9M5P8|SNAA_SOLTU Alpha-soluble NSF attachment protein OS=Solanum tuberosum PE=2 SV=1 1 120 8.0E-29
sp|Q9SPE6|SNAA2_ARATH Alpha-soluble NSF attachment protein 2 OS=Arabidopsis thaliana GN=ASNAP2 PE=1 SV=1 8 120 1.0E-26
sp|P93798|SNAA_VITVI Alpha-soluble NSF attachment protein OS=Vitis vinifera PE=2 SV=1 1 120 2.0E-26
sp|P28663|SNAB_MOUSE Beta-soluble NSF attachment protein OS=Mus musculus GN=Napb PE=1 SV=2 8 122 5.0E-24
sp|Q9H115|SNAB_HUMAN Beta-soluble NSF attachment protein OS=Homo sapiens GN=NAPB PE=1 SV=2 8 122 5.0E-24
sp|P85969|SNAB_RAT Beta-soluble NSF attachment protein OS=Rattus norvegicus GN=Napb PE=1 SV=1 8 122 5.0E-24
sp|P54920|SNAA_HUMAN Alpha-soluble NSF attachment protein OS=Homo sapiens GN=NAPA PE=1 SV=3 2 124 2.0E-23
sp|P81126|SNAB_BOVIN Beta-soluble NSF attachment protein OS=Bos taurus GN=NAPB PE=1 SV=1 8 122 2.0E-23
sp|Q54NP6|SNAA_DICDI Alpha-soluble NSF attachment protein OS=Dictyostelium discoideum GN=snpA PE=1 SV=1 8 118 2.0E-23
sp|P54921|SNAA_RAT Alpha-soluble NSF attachment protein OS=Rattus norvegicus GN=Napa PE=1 SV=2 8 124 2.0E-22
sp|Q9DB05|SNAA_MOUSE Alpha-soluble NSF attachment protein OS=Mus musculus GN=Napa PE=1 SV=1 8 124 2.0E-22
sp|P78603|SEC17_COPC7 Vesicular-fusion protein SEC17 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=SEC17 PE=3 SV=2 8 119 4.0E-22
sp|Q23983|SNAP_DROME Alpha-soluble NSF attachment protein OS=Drosophila melanogaster GN=alphaSnap PE=1 SV=1 2 115 9.0E-22
sp|P81125|SNAA_BOVIN Alpha-soluble NSF attachment protein OS=Bos taurus GN=NAPA PE=1 SV=1 8 124 2.0E-21
sp|Q75D68|SEC17_ASHGO Vesicular-fusion protein SEC17 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SEC17 PE=3 SV=1 1 118 7.0E-21
sp|P32602|SEC17_YEAST Alpha-soluble NSF attachment protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC17 PE=1 SV=4 1 119 1.0E-18
sp|Q9P4D0|SEC17_PICPG Vesicular-fusion protein SEC17 OS=Komagataella pastoris (strain GS115 / ATCC 20864) GN=SEC17 PE=3 SV=2 7 119 5.0E-18
sp|Q9LXZ5|SNAA1_ARATH Alpha-soluble NSF attachment protein 1 OS=Arabidopsis thaliana GN=ASNAP1 PE=1 SV=1 19 103 1.0E-13
sp|Q9J5J0|V011_FOWPN Soluble NSF attachment protein homolog FPV011 OS=Fowlpox virus (strain NVSL) GN=FPV011 PE=3 SV=1 7 115 4.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup893
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1132 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|4348
Ophiocordyceps australis map64 (Brazil) OphauB2|3275
Ophiocordyceps camponoti-floridani Ophcf2|06674
Ophiocordyceps camponoti-rufipedis Ophun1|107
Ophiocordyceps kimflemingae Ophio5|7459
Ophiocordyceps subramaniannii Hirsu2|5743

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1132
MAALNSDYYHAIEIYEKVADQSINNNLMKYSVKDYLLKAGICHLATRDLIAVEQAIDKYCKLDQAFATQRESMLL
RDLLEALTAGSQEQFTDKLLQYDQVSKLDKWKTALLSRVKNEMQADGSDTEFA*
Coding >OphauG2|1132
ATGGCGGCGCTCAATAGCGACTACTACCACGCCATTGAAATCTACGAAAAGGTGGCGGATCAGTCCATCAACAAC
AACCTTATGAAGTACAGCGTTAAGGACTATCTCCTCAAGGCAGGCATTTGCCACTTGGCGACGCGCGATCTCATT
GCCGTGGAACAGGCCATTGACAAATACTGCAAATTGGATCAGGCCTTTGCCACACAGCGCGAAAGCATGTTGTTG
AGAGACTTGCTAGAGGCTCTGACGGCGGGTAGCCAAGAGCAATTCACCGACAAGCTCTTACAGTATGACCAGGTC
AGCAAACTCGACAAGTGGAAGACGGCACTATTATCGCGTGTTAAGAACGAAATGCAAGCCGACGGCTCGGATACA
GAGTTTGCCTGA
Transcript >OphauG2|1132
ATGGCGGCGCTCAATAGCGACTACTACCACGCCATTGAAATCTACGAAAAGGTGGCGGATCAGTCCATCAACAAC
AACCTTATGAAGTACAGCGTTAAGGACTATCTCCTCAAGGCAGGCATTTGCCACTTGGCGACGCGCGATCTCATT
GCCGTGGAACAGGCCATTGACAAATACTGCAAATTGGATCAGGCCTTTGCCACACAGCGCGAAAGCATGTTGTTG
AGAGACTTGCTAGAGGCTCTGACGGCGGGTAGCCAAGAGCAATTCACCGACAAGCTCTTACAGTATGACCAGGTC
AGCAAACTCGACAAGTGGAAGACGGCACTATTATCGCGTGTTAAGAACGAAATGCAAGCCGACGGCTCGGATACA
GAGTTTGCCTGA
Gene >OphauG2|1132
ATGGCGGCGCTCAATAGCGACTACTACCACGCCATTGAAATCTACGAAAAGGTGGCGGATCAGTCCATCAACAAC
AACCTTATGAAGTACAGCGTTAAGGACTATCTCCTCAAGGCAGGCATTTGCCACTTGGCGACGCGCGATCTCATT
GCCGTGGAACAGGCCATTGACAAATACTGCAAATTGGATCAGGCCTTTGCCACACAGCGCGAAAGCATGTTGTTG
AGAGACTTGCTAGAGGCTCTGACGGCGGGTAGCCAAGAGCAATTCACCGACAAGCTCTTACAGTATGACCAGGTC
AGCAAACTCGACAAGTGGAAGACGGCACTATTATCGCGTGTTAAGAACGAAATGCAAGCCGACGGCTCGGATACA
GAGTTTGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail