Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|113
Gene name
LocationContig_101:20061..24076
Strand+
Gene length (bp)4015
Transcript length (bp)3321
Coding sequence length (bp)3321
Protein length (aa) 1107

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 3.3E-63 489 679
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.1E-15 679 762
PF00929 RNase_T Exonuclease 5.5E-25 838 1011

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 1 1091 0.0E+00
sp|Q5BBL5|PAN2_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q2ULU6|PAN2_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan2 PE=3 SV=1 1 1106 0.0E+00
sp|A1DFN6|PAN2_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q0CJU7|PAN2_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan2 PE=3 SV=1 1 1097 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q0UPL5|PAN2_PHANO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAN2 PE=3 SV=1 1 1091 0.0E+00
sp|Q5BBL5|PAN2_EMENI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q2ULU6|PAN2_ASPOR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=pan2 PE=3 SV=1 1 1106 0.0E+00
sp|A1DFN6|PAN2_NEOFI PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q0CJU7|PAN2_ASPTN PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=pan2 PE=3 SV=1 1 1097 0.0E+00
sp|A1CEK7|PAN2_ASPCL PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|Q4WHP6|PAN2_ASPFU PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pan2 PE=3 SV=1 1 1075 0.0E+00
sp|P0C581|PAN2_NEUCR PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pan2 PE=1 SV=2 4 1099 0.0E+00
sp|Q1E873|PAN2_COCIM PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Coccidioides immitis (strain RS) GN=PAN2 PE=3 SV=2 1 1068 0.0E+00
sp|A4RF51|PAN2_MAGO7 PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAN2 PE=3 SV=3 1 1085 0.0E+00
sp|A2QW83|PAN2_ASPNC PAB-dependent poly(A)-specific ribonuclease subunit pan2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=pan2 PE=3 SV=1 1 1102 0.0E+00
sp|Q09798|PAN2_SCHPO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pan2 PE=3 SV=2 26 1042 0.0E+00
sp|P0CQ08|PAN2_CRYNJ PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|P0CQ09|PAN2_CRYNB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAN2 PE=3 SV=1 27 1106 0.0E+00
sp|Q2GSV2|PAN2_CHAGB PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAN2 PE=3 SV=2 1 1064 0.0E+00
sp|Q6BZ78|PAN2_DEBHA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PAN2 PE=3 SV=2 1 1042 5.0E-169
sp|A5DAD0|PAN2_PICGU PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PAN2 PE=3 SV=3 1 1042 2.0E-168
sp|Q6CMN5|PAN2_KLULA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PAN2 PE=3 SV=1 26 1042 8.0E-159
sp|Q6C462|PAN2_YARLI PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PAN2 PE=3 SV=2 1 1043 6.0E-153
sp|Q754X1|PAN2_ASHGO PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PAN2 PE=3 SV=2 27 1042 3.0E-152
sp|P53010|PAN2_YEAST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PAN2 PE=1 SV=1 26 1043 7.0E-134
sp|Q6FS70|PAN2_CANGA PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PAN2 PE=3 SV=1 26 1042 1.0E-123
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 1 678 2.0E-80
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 1 678 1.0E-79
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 1 670 4.0E-79
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 1 678 4.0E-78
sp|Q6IE70|PAN2_RAT PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Rattus norvegicus GN=Pan2 PE=2 SV=1 711 1049 6.0E-77
sp|Q504Q3|PAN2_HUMAN PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Homo sapiens GN=PAN2 PE=1 SV=3 711 1049 7.0E-77
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 680 1049 4.0E-76
sp|Q8BGF7|PAN2_MOUSE PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Mus musculus GN=Pan2 PE=1 SV=1 713 1049 5.0E-76
sp|Q5F450|PAN2_CHICK PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Gallus gallus GN=PAN2 PE=2 SV=1 18 678 4.0E-75
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 1 645 3.0E-74
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 24 646 7.0E-69
sp|A3LRV8|PAN2_PICST PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PAN2 PE=3 SV=2 753 1043 2.0E-66
sp|A5E1W0|PAN2_LODEL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PAN2 PE=3 SV=1 716 1043 2.0E-64
sp|Q5APK0|PAN2_CANAL PAB-dependent poly(A)-specific ribonuclease subunit PAN2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PAN2 PE=3 SV=1 716 1043 4.0E-63
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 752 1031 1.0E-39
sp|P53015|YPO4_CAEEL Uncharacterized protein F31E3.4 OS=Caenorhabditis elegans GN=F31E3.4 PE=4 SV=1 26 547 2.0E-21
sp|Q9CZI9|AEN_MOUSE Apoptosis-enhancing nuclease OS=Mus musculus GN=Aen PE=2 SV=1 831 1012 5.0E-14
sp|Q2T9U5|REXON_BOVIN Putative RNA exonuclease NEF-sp OS=Bos taurus PE=2 SV=1 870 1031 2.0E-13
sp|Q96IC2|REXON_HUMAN Putative RNA exonuclease NEF-sp OS=Homo sapiens GN=44M2.3 PE=2 SV=1 870 1036 9.0E-13
sp|A1A5R7|REXON_RAT Putative RNA exonuclease NEF-sp OS=Rattus norvegicus PE=2 SV=1 870 1030 4.0E-12
sp|Q5REE2|AEN_PONAB Apoptosis-enhancing nuclease OS=Pongo abelii GN=AEN PE=2 SV=1 832 1012 2.0E-11
sp|Q8WTP8|AEN_HUMAN Apoptosis-enhancing nuclease OS=Homo sapiens GN=AEN PE=1 SV=2 832 1012 2.0E-11
sp|Q757I9|REXO4_ASHGO RNA exonuclease 4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=REX4 PE=3 SV=1 838 1018 1.0E-10
sp|Q6PAQ4|REXO4_MOUSE RNA exonuclease 4 OS=Mus musculus GN=Rexo4 PE=2 SV=2 838 1011 2.0E-10
sp|Q9GZR2|REXO4_HUMAN RNA exonuclease 4 OS=Homo sapiens GN=REXO4 PE=1 SV=2 871 1029 5.0E-10
sp|Q4PER6|REXO4_USTMA RNA exonuclease 4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=REX4 PE=3 SV=1 826 1049 6.0E-10
sp|Q5A3Q0|REXO4_CANAL RNA exonuclease 4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=REX4 PE=3 SV=1 828 1014 1.0E-08
sp|Q91560|REXO4_XENLA RNA exonuclease 4 OS=Xenopus laevis GN=rexo4 PE=2 SV=2 823 1011 2.0E-08
sp|Q6FQA0|REXO4_CANGA RNA exonuclease 4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=REX4 PE=3 SV=1 838 1012 2.0E-08
sp|Q4IEV5|REXO4_GIBZE RNA exonuclease 4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=REX4 PE=3 SV=1 869 1014 3.0E-08
sp|Q9H9L3|I20L2_HUMAN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Homo sapiens GN=ISG20L2 PE=1 SV=1 834 1012 1.0E-07
sp|Q2YDK1|I20L2_BOVIN Interferon-stimulated 20 kDa exonuclease-like 2 OS=Bos taurus GN=ISG20L2 PE=2 SV=1 834 1012 1.0E-07
sp|Q6BIK6|REXO4_DEBHA RNA exonuclease 4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=REX4 PE=3 SV=2 828 1020 1.0E-07
sp|P53331|REXO1_YEAST RNA exonuclease 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RNH70 PE=1 SV=1 869 1012 1.0E-07
sp|Q8RXK2|SDN3_ARATH Small RNA degrading nuclease 3 OS=Arabidopsis thaliana GN=SDN3 PE=1 SV=1 869 1010 1.0E-07
sp|P0CQ44|REXO4_CRYNJ RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=REX4 PE=3 SV=1 834 1038 1.0E-07
sp|P0CQ45|REXO4_CRYNB RNA exonuclease 4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=REX4 PE=3 SV=1 834 1038 1.0E-07
sp|Q08237|REXO4_YEAST RNA exonuclease 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=REX4 PE=1 SV=1 838 1013 4.0E-07
sp|Q6CMT3|REXO4_KLULA RNA exonuclease 4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=REX4 PE=3 SV=1 833 1018 1.0E-06
sp|Q66UW5|ISG20_PIG Interferon-stimulated gene 20 kDa protein OS=Sus scrofa GN=Isg20 PE=1 SV=2 833 1012 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|113
MDGDWDEVSRIPFPPPGGVHSMPSPVTTMTFDTSHELLWAGNEFGRVTSFISPDLQKYTSFKAHLSSDGPVRQIL
VNDKGIIALGARDLHMAMRRGPPIWHLRHDDMMDMRCMGFTSKGTTEVLVAGLQDKLLLVDLAKGEVVKQLRTEH
NYSIIKSGRYICAATQTGSVHLLDPVSLSLVRSWNAHSALINDMDTQHDFIVTCGYSLRQGQAYMLDPFLNIFDI
KKMTSMPPIPFPAGAAYVRMHPRMQTTSIVVSQVGQMHVIDLMNPNTSNVRQANVLTYLSMFEIAPSGEALALTD
PECFIHLWGSPTKLHFVDLPTPLEFATAVEPRPPIEWTADTPLNTIGLPYYRETLFSAWPDLVCDVGAPPPRIDA
QFLSGLKAAEFGLYGRNSRGLRRNQAENTRNGGKLAASGLKAPKFLSEKARELAKDESRNLEERTDDLASPTVDV
DLVSKKSEVPVMYRNVEIKYSKFGVDDFDFGYYNKTRYSGLEIHISNSYANSLLQIMNFTPLIRNLALEHAATAC
VSDSCLLCELGFLFDMLQKADGSICQATNLLRTLSHHPQAAPLGLLEEDAHSSSLNVMLQGLTRFMLDKIVQDYK
SMAPSPMTMEHALATSATSSIRCMSCRSEYTRPGSTYVNDLLYPPQKTSIRGNKPSSITFSQVLKSSIERETTSK
GWCSWLPEEVGVIVDQGQFYCYEGEDLKLHLQRGMHNIIVYSLIGMAVNIESGQAQKPHLVAMVNVALSQPQAPN
QSQWHLFNDFLVRPISTEDALAFNISWKVPSVVAFQMKEANNKINDDWKLKLDTSILYRDFGPATQLAHKTYQVL
DPDRERPGPDSIVALDTEFVAVRQPEIEMNSDGERETIRPIVYALARVSVVRGQGEQEGRPFVDDYIAIKEPIVD
YLTSYSGIRQGDLDPRTSNHSLVSLKMAYKKLWLLVNLGCRFLGHGLRQDFRVINIHVPRAQVIDTIDLFFLRSR
LRKLSLAFLAWYLLKEDIQMETHDSIEDARTALKLYRKYLEFQDAGIWDTMLQDIYRAGREVNFRPPKRDESASV
TGVGLQGTESPPLSGDGTATLPSTPVPKPAVLAGAATAFGGGSWTPGKSGGPSPLR*
Coding >OphauG2|113
ATGGATGGAGACTGGGACGAGGTCTCCCGCATCCCTTTCCCGCCTCCGGGCGGCGTCCACTCGATGCCATCGCCG
GTGACGACAATGACGTTTGATACGTCTCACGAGCTTCTCTGGGCTGGGAATGAATTTGGTCGCGTCACCTCCTTC
ATCAGTCCAGACCTGCAGAAATACACGTCTTTCAAGGCCCATCTATCCTCGGACGGCCCGGTCCGCCAGATCTTG
GTCAATGACAAGGGTATCATTGCTCTAGGAGCAAGGGACCTTCACATGGCAATGCGGAGAGGGCCTCCAATTTGG
CACCTAAGACACGACGACATGATGGATATGCGATGCATGGGCTTTACATCCAAAGGCACCACAGAGGTGCTTGTA
GCTGGCTTACAAGATAAGCTACTGCTTGTCGACCTTGCTAAGGGAGAGGTGGTCAAGCAGCTCAGGACAGAGCAT
AACTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCAGACCGGATCTGTTCATCTCTTGGATCCC
GTCAGCTTGAGTCTCGTTCGGTCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACGCAACATGACTTT
ATCGTTACTTGTGGTTACTCTCTGCGTCAGGGCCAGGCGTACATGCTCGATCCATTCCTAAACATCTTTGACATC
AAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCATCCCAGAATGCAG
ACCACTAGCATAGTCGTCTCGCAGGTCGGACAGATGCATGTTATCGATCTTATGAACCCCAATACCAGCAATGTT
CGTCAGGCAAATGTGCTTACGTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAAGCTCTAGCCCTCACCGAT
CCCGAATGTTTTATACATCTCTGGGGCTCGCCCACCAAGCTGCATTTTGTTGATCTTCCCACTCCCCTTGAATTT
GCCACTGCGGTCGAGCCGCGGCCTCCCATAGAATGGACAGCAGACACCCCTTTGAACACGATTGGATTGCCATAC
TATAGAGAAACTCTTTTTTCCGCCTGGCCAGATCTTGTGTGTGATGTCGGCGCTCCTCCGCCCCGCATAGACGCT
CAATTTCTGAGTGGACTCAAGGCGGCCGAATTCGGCCTCTATGGACGAAATAGTCGTGGTTTGCGAAGAAATCAA
GCCGAGAACACACGAAATGGTGGGAAACTGGCAGCTTCTGGGCTCAAGGCTCCTAAATTCTTGAGCGAAAAGGCT
CGCGAACTTGCCAAAGACGAATCGAGGAACCTGGAAGAAAGAACAGACGACTTGGCAAGCCCCACGGTCGACGTC
GACCTTGTCAGCAAAAAGAGTGAGGTGCCCGTCATGTATCGCAATGTTGAAATCAAGTACAGCAAGTTTGGTGTC
GACGATTTCGATTTTGGATACTATAACAAGACGCGGTATTCTGGGTTGGAAATTCACATTTCCAACTCGTACGCC
AATTCCCTGCTGCAGATTATGAACTTTACGCCTCTTATCCGCAACCTTGCCCTAGAACATGCCGCAACAGCCTGT
GTTAGCGACTCGTGTCTGCTTTGCGAACTGGGGTTCTTGTTTGACATGCTCCAAAAAGCAGACGGCTCAATATGT
CAAGCCACCAACCTGCTCAGGACCCTGAGCCATCACCCTCAAGCTGCTCCTCTGGGTCTTCTGGAAGAAGATGCG
CACAGCTCATCCTTGAATGTGATGCTACAAGGGCTCACGCGTTTCATGCTGGACAAGATTGTACAGGACTATAAA
AGCATGGCACCGTCCCCTATGACAATGGAACATGCCCTTGCAACTTCGGCCACCAGCTCTATCCGCTGCATGAGT
TGCAGGTCCGAGTACACTCGGCCAGGGTCAACTTATGTCAATGATCTGCTCTACCCTCCACAGAAGACTTCGATA
CGTGGCAACAAGCCATCAAGCATCACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGAGAAACGACATCCAAG
GGCTGGTGCAGTTGGCTTCCGGAAGAGGTGGGTGTCATAGTAGACCAAGGACAGTTCTACTGCTACGAAGGGGAA
GACCTGAAACTGCATTTACAGCGAGGCATGCATAACATCATTGTGTACTCGCTTATTGGCATGGCGGTCAATATT
GAGAGCGGCCAGGCTCAGAAGCCGCATCTTGTGGCCATGGTCAACGTGGCACTATCGCAGCCACAGGCTCCTAAT
CAGAGCCAGTGGCATCTGTTCAACGACTTCCTAGTCCGCCCCATCAGCACAGAGGACGCTCTCGCATTCAATATT
TCGTGGAAAGTCCCCTCAGTCGTGGCTTTCCAAATGAAGGAGGCCAATAATAAGATTAATGACGACTGGAAACTG
AAGCTGGACACTTCAATTCTTTATCGAGACTTTGGTCCTGCGACACAGCTAGCGCACAAAACATACCAGGTCTTG
GACCCCGACCGTGAGCGTCCGGGGCCTGATTCAATAGTGGCGCTGGACACCGAGTTTGTCGCTGTTCGGCAACCA
GAAATTGAGATGAATTCGGACGGCGAGCGCGAGACAATTCGGCCCATAGTATATGCTCTTGCACGAGTGTCCGTA
GTTCGCGGTCAGGGAGAGCAAGAGGGGCGCCCGTTTGTCGATGACTACATTGCCATCAAGGAGCCCATTGTTGAC
TATCTCACGTCATACTCTGGCATTCGACAGGGCGATCTGGATCCTCGTACCTCGAACCACAGCCTCGTGTCACTC
AAGATGGCCTACAAAAAACTTTGGCTGCTAGTCAATCTTGGCTGCCGGTTCCTCGGCCATGGCCTGCGGCAGGAC
TTTCGCGTCATCAACATTCATGTGCCCCGCGCACAGGTGATTGACACTATTGACCTTTTCTTTTTGCGATCGCGG
CTGCGCAAGCTGTCACTTGCATTCCTGGCATGGTATCTTCTCAAGGAAGATATACAAATGGAAACGCACGACTCG
ATTGAGGACGCCCGCACTGCCCTTAAATTGTATCGCAAGTACCTCGAGTTTCAGGATGCAGGCATCTGGGACACG
ATGCTGCAGGATATCTACCGGGCAGGCAGAGAAGTCAACTTCCGGCCGCCAAAGAGGGACGAGAGCGCTTCTGTT
ACTGGTGTTGGACTACAAGGAACAGAGTCGCCGCCCTTGTCTGGTGATGGCACCGCAACGCTGCCATCAACGCCC
GTCCCCAAGCCGGCAGTGCTGGCTGGCGCTGCAACAGCGTTTGGTGGTGGTAGCTGGACTCCGGGAAAGAGTGGT
GGTCCTTCGCCACTACGGTAG
Transcript >OphauG2|113
ATGGATGGAGACTGGGACGAGGTCTCCCGCATCCCTTTCCCGCCTCCGGGCGGCGTCCACTCGATGCCATCGCCG
GTGACGACAATGACGTTTGATACGTCTCACGAGCTTCTCTGGGCTGGGAATGAATTTGGTCGCGTCACCTCCTTC
ATCAGTCCAGACCTGCAGAAATACACGTCTTTCAAGGCCCATCTATCCTCGGACGGCCCGGTCCGCCAGATCTTG
GTCAATGACAAGGGTATCATTGCTCTAGGAGCAAGGGACCTTCACATGGCAATGCGGAGAGGGCCTCCAATTTGG
CACCTAAGACACGACGACATGATGGATATGCGATGCATGGGCTTTACATCCAAAGGCACCACAGAGGTGCTTGTA
GCTGGCTTACAAGATAAGCTACTGCTTGTCGACCTTGCTAAGGGAGAGGTGGTCAAGCAGCTCAGGACAGAGCAT
AACTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCAGACCGGATCTGTTCATCTCTTGGATCCC
GTCAGCTTGAGTCTCGTTCGGTCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACGCAACATGACTTT
ATCGTTACTTGTGGTTACTCTCTGCGTCAGGGCCAGGCGTACATGCTCGATCCATTCCTAAACATCTTTGACATC
AAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCATCCCAGAATGCAG
ACCACTAGCATAGTCGTCTCGCAGGTCGGACAGATGCATGTTATCGATCTTATGAACCCCAATACCAGCAATGTT
CGTCAGGCAAATGTGCTTACGTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAAGCTCTAGCCCTCACCGAT
CCCGAATGTTTTATACATCTCTGGGGCTCGCCCACCAAGCTGCATTTTGTTGATCTTCCCACTCCCCTTGAATTT
GCCACTGCGGTCGAGCCGCGGCCTCCCATAGAATGGACAGCAGACACCCCTTTGAACACGATTGGATTGCCATAC
TATAGAGAAACTCTTTTTTCCGCCTGGCCAGATCTTGTGTGTGATGTCGGCGCTCCTCCGCCCCGCATAGACGCT
CAATTTCTGAGTGGACTCAAGGCGGCCGAATTCGGCCTCTATGGACGAAATAGTCGTGGTTTGCGAAGAAATCAA
GCCGAGAACACACGAAATGGTGGGAAACTGGCAGCTTCTGGGCTCAAGGCTCCTAAATTCTTGAGCGAAAAGGCT
CGCGAACTTGCCAAAGACGAATCGAGGAACCTGGAAGAAAGAACAGACGACTTGGCAAGCCCCACGGTCGACGTC
GACCTTGTCAGCAAAAAGAGTGAGGTGCCCGTCATGTATCGCAATGTTGAAATCAAGTACAGCAAGTTTGGTGTC
GACGATTTCGATTTTGGATACTATAACAAGACGCGGTATTCTGGGTTGGAAATTCACATTTCCAACTCGTACGCC
AATTCCCTGCTGCAGATTATGAACTTTACGCCTCTTATCCGCAACCTTGCCCTAGAACATGCCGCAACAGCCTGT
GTTAGCGACTCGTGTCTGCTTTGCGAACTGGGGTTCTTGTTTGACATGCTCCAAAAAGCAGACGGCTCAATATGT
CAAGCCACCAACCTGCTCAGGACCCTGAGCCATCACCCTCAAGCTGCTCCTCTGGGTCTTCTGGAAGAAGATGCG
CACAGCTCATCCTTGAATGTGATGCTACAAGGGCTCACGCGTTTCATGCTGGACAAGATTGTACAGGACTATAAA
AGCATGGCACCGTCCCCTATGACAATGGAACATGCCCTTGCAACTTCGGCCACCAGCTCTATCCGCTGCATGAGT
TGCAGGTCCGAGTACACTCGGCCAGGGTCAACTTATGTCAATGATCTGCTCTACCCTCCACAGAAGACTTCGATA
CGTGGCAACAAGCCATCAAGCATCACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGAGAAACGACATCCAAG
GGCTGGTGCAGTTGGCTTCCGGAAGAGGTGGGTGTCATAGTAGACCAAGGACAGTTCTACTGCTACGAAGGGGAA
GACCTGAAACTGCATTTACAGCGAGGCATGCATAACATCATTGTGTACTCGCTTATTGGCATGGCGGTCAATATT
GAGAGCGGCCAGGCTCAGAAGCCGCATCTTGTGGCCATGGTCAACGTGGCACTATCGCAGCCACAGGCTCCTAAT
CAGAGCCAGTGGCATCTGTTCAACGACTTCCTAGTCCGCCCCATCAGCACAGAGGACGCTCTCGCATTCAATATT
TCGTGGAAAGTCCCCTCAGTCGTGGCTTTCCAAATGAAGGAGGCCAATAATAAGATTAATGACGACTGGAAACTG
AAGCTGGACACTTCAATTCTTTATCGAGACTTTGGTCCTGCGACACAGCTAGCGCACAAAACATACCAGGTCTTG
GACCCCGACCGTGAGCGTCCGGGGCCTGATTCAATAGTGGCGCTGGACACCGAGTTTGTCGCTGTTCGGCAACCA
GAAATTGAGATGAATTCGGACGGCGAGCGCGAGACAATTCGGCCCATAGTATATGCTCTTGCACGAGTGTCCGTA
GTTCGCGGTCAGGGAGAGCAAGAGGGGCGCCCGTTTGTCGATGACTACATTGCCATCAAGGAGCCCATTGTTGAC
TATCTCACGTCATACTCTGGCATTCGACAGGGCGATCTGGATCCTCGTACCTCGAACCACAGCCTCGTGTCACTC
AAGATGGCCTACAAAAAACTTTGGCTGCTAGTCAATCTTGGCTGCCGGTTCCTCGGCCATGGCCTGCGGCAGGAC
TTTCGCGTCATCAACATTCATGTGCCCCGCGCACAGGTGATTGACACTATTGACCTTTTCTTTTTGCGATCGCGG
CTGCGCAAGCTGTCACTTGCATTCCTGGCATGGTATCTTCTCAAGGAAGATATACAAATGGAAACGCACGACTCG
ATTGAGGACGCCCGCACTGCCCTTAAATTGTATCGCAAGTACCTCGAGTTTCAGGATGCAGGCATCTGGGACACG
ATGCTGCAGGATATCTACCGGGCAGGCAGAGAAGTCAACTTCCGGCCGCCAAAGAGGGACGAGAGCGCTTCTGTT
ACTGGTGTTGGACTACAAGGAACAGAGTCGCCGCCCTTGTCTGGTGATGGCACCGCAACGCTGCCATCAACGCCC
GTCCCCAAGCCGGCAGTGCTGGCTGGCGCTGCAACAGCGTTTGGTGGTGGTAGCTGGACTCCGGGAAAGAGTGGT
GGTCCTTCGCCACTACGGTAG
Gene >OphauG2|113
ATGGATGGAGACTGGGACGAGGTGAGCCGCTGGTTGTCGCGCCCGGTCACGATTGATGCTTCATGGCTAATTGGG
CAGGTCTCCCGCATCCCTTTCCCGCCTCCGGGCGGCGTCCACTCGATGCCATCGCCGGTGACGACAATGACGTTT
GATACGTCTCACGAGCTTCTCTGGGCTGGGAATGAATTTGTACGTGGCATGATTTGGATTTCGTCTCGACAATGC
CAAAGCTCTTACTCTCTTCGACGGCTAGGGTCGCGTCACCTCCTTCATCAGTCCAGACCTGCAGAAATACACGTC
TTTCAAGGCCCATCTATCCTCGGACGGCCCGGTCCGCCAGATCTTGGTCAATGACAAGGGTATCATTGCTCTAGG
AGCAAGGGACCTTCACATGGCAATGCGGAGAGGGCCTCCAATTTGGCACCTAAGGTGCGGCATGCCAGCCAGGCT
TCCTCTTGCAACCCCCCTCCCCGACTAACTCTGCTGGTCAAGACACGACGACATGATGGATATGCGATGCATGGG
CTTTACATCCAAAGGCACCACAGAGGTGCTTGTAGCTGGCTTACAAGATAAGCTACTGCTTGTCGACCTTGCTAA
GGGAGAGGTGGTCAAGCAGGTGAGCCTCTACCTCTATTCGCGCCGCTGGAGCCTCCCACTCATGAACTGCAGCTC
AGGACAGAGCATAACTACTCCATCATCAAGAGTGGCCGGTACATATGCGCCGCCACTCAGACCGGATCTGTTCAT
CTCTTGGATCCCGTCAGCTTGAGTCTCGTTCGGTCGTGGAACGCCCACTCGGCCTTGATCAACGACATGGATACG
CAACATGACTTTATCGTTACTTGTGGTTACTCTCTGCGTCAGGGCCAGGCGTACATGCTCGATCCATTCCTAAAC
ATCTTTGACATCAAGAAAATGACATCGATGCCTCCAATTCCATTTCCCGCTGGCGCTGCCTATGTTCGCATGCAT
CCCAGAATGCAGACCACTAGCATAGTCGTCTCGCAGGTCGGACAGATGCATGTTATCGATCTTATGAACCCCAAT
ACCAGCAATGTTCGTCAGGCAAATGTGCTTACGTACCTCAGCATGTTTGAGATTGCTCCCTCGGGAGAAGCTCTA
GCCCTCACCGATCCCGAATGTTTTATACATCTCTGGGGCTCGCCCACCAAGCTGCATTTTGTTGATCTTCCCACT
CCCCTTGAATTTGCCACTGCGGTCGAGCCGCGGCCTCCCATAGAATGGACAGCAGACACGTGCGTGTGCTTGTCC
TTGCTCCTTCTTCGTCTCATGCTGACATGGCGACAGCCCTTTGAACACGATTGGATTGCCATACTATAGAGAAAC
TCTTTTTTCCGCCTGGCCAGATCTTGTGTGTGATGTCGGCGCTCCTCCGCCCCGCATAGACGCTCAATTTCTGAG
TGGACTCAAGGCGGCCGAATTCGGCCTCTATGGACGAAATAGTCGTGGTTTGCGAAGAAATCAAGCCGAGAACAC
ACGAAATGGTGGGAAACTGGCAGCTTCTGGGCTCAAGGCTCCTAAATTCTTGAGCGAAAAGGCTCGCGAACTTGC
CAAAGACGAATCGAGGAACCTGGAAGAAAGAACAGACGACTTGGCAAGCCCCACGGTCGACGTCGACCTTGTCAG
CAAAAAGAGTGAGGTGCCCGTCATGTATCGCAATGTTGAAATCAAGTACAGCAAGTTTGGTGTCGACGATTTCGA
TTTTGGGTGCGCAACCCCAAAGCTCCCCCTGGTCAAAGGCCTTGGCTCATCAGACACAGATACTATAACAAGACG
CGGTATTCTGGGTTGGAAATTCACATTTCCAACTCGTACGCCAATTCCCTGCTGCAGATTATGAACTTTACGCCT
CTTATCCGCAACCTTGCCCTAGAACATGCCGCAACAGCCTGTGTTAGCGACTCGTGTCTGCTTTGCGAACTGGGG
TTCTTGTTTGACATGCTCCAAAAAGCAGACGGCTCAATATGTCAAGCCACCAACCTGCTCAGGACCCTGAGCCAT
CACCCTCAAGCTGCTCCTCTGGGTCTTCTGGAAGAAGATGCGCACAGCTCATCCTTGAATGTGATGCTACAAGGG
CTCACGCGTTTCATGCTGGACAAGATTGTACAGGACTATAAAAGCATGGCACCGTCCCCTATGACAATGGAACAT
GTAGCCACTCCCCATCATGATTCTCTCGTGGACTGACGTCTGTTTGCTGACCATGGACAGGCCCTTGCAACTTCG
GCCACCAGCTCTATCCGCTGCATGAGTTGCAGGTCCGAGTACACTCGGCCAGGGTCAACTTATGTCAATGATCTG
CTCTACCCTCCACAGGTGTGTTAGATATTCTGACAGTTTCTGTCCAAGTGATTGCTCACGGTGCCGAGCAGAAGA
CTTCGATACGTGGCAACAAGCCATCAAGCATCACCTTCTCTCAAGTATTGAAGAGTAGCATAGAGAGAGAAACGA
CATCCAAGGGCTGGTGCAGTAGGTGCCAACGATACCAGACAATCGCAACGAGGAAAACAATACACAGTATCCCGG
CTGTGCTGATGCTCAATACTGCCATTACAAGTCTTGACCATCGCATGCTTTGGTCAACTCCAGGTTGGCTTCCGG
AAGAGGTGGGTGTCATAGTAGACCAAGGACAGTTCTACTGCTACGAAGGGGAAGACCTGAAACTGCATTTACAGC
GAGGCATGCATAACATCATTGTGTACTCGCTTATTGGCATGGCGGTCAATATTGAGAGCGGCCAGGCTCAGAAGC
CGCATCTTGTGGCCATGGTCAACGGTAGGCTTTGGTTTTGGCCTTGAACAAGTCATCCGTTGGCTGACTAGATTT
GTAGTGGCACTATCGCAGCCACAGGCTCCTAATCAGAGCCAGTGGCATCTGTTCAACGACTTCCTAGTCCGCCCC
ATCAGCACAGAGGACGCTCTCGCATTCAATATTTCGTGGAAAGTCCCCTCAGTCGTGGCTTTCCAAATGAAGGAG
GCCAATAATAAGATTAATGACGACTGGAAACTGAAGCTGGACACTTCAATTCTTTATCGAGACTTTGGGTAAGTA
AATGGGCTTCAAGACAAGATGGCAGCGCCTTTGATTGACGTGATGCCGCTGCAGTCCTGCGACACAGCTAGCGCA
CAAAACATACCAGGTCTTGGACCCCGACCGTGAGCGTCCGGGGCCTGATTCAATAGTGGCGCTGGACACCGAGTT
TGTCGCTGTTCGGCAACCAGAAATTGAGATGAATTCGGACGGCGAGCGCGAGACAATTCGGCCCATAGTATATGC
TCTTGCACGAGTGTCCGTAGTTCGCGGTCAGGGAGAGCAAGAGGGGCGCCCGTTTGTCGATGACTACATTGCCAT
CAAGGAGCCCATTGTTGACTATCTCACGTCATACTCTGGCATTCGACAGGGCGATCTGGATCCTCGTACCTCGAA
CCACAGCCTCGTGTCACTCAAGATGGCCTACAAAAAACTTTGGCTGCTAGTCAATCTTGGCTGCCGGTTCCTCGG
CCATGGCCTGCGGCAGGACTTTCGCGTCATCAACATTCATGTGCCCCGCGCACAGGTGATTGACACTATTGACCT
TTTCTTTTTGCGATCGCGGCTGCGCAAGCTGTCACTTGCATTCCTGGCATGGTATCTTCTCAAGGAAGATATACA
AATGGAAACGCACGACTCGATTGAGGACGCCCGCACTGCCCTTAAATTGTATCGCAAGTACCTCGAGTTTCAGGA
TGCAGGCATCTGGGACACGATGCTGCAGGATATCTACCGGGCAGGCAGAGAAGTCAACTTCCGGCCGCCAAAGAG
GGACGAGAGCGCTTCTGTTACTGGTGTTGGACTACAAGGAACAGAGTCGCCGCCCTTGTCTGGTGATGGCACCGC
AACGCTGCCATCAACGCCCGTCCCCAAGCCGGCAGTGCTGGCTGGCGCTGCAACAGCGTTTGGTGGTGGTAGCTG
GACTCCGGGAAAGAGTGGTGGTCCTTCGCCACTACGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail