Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1124
Gene name
LocationContig_131:24260..31334
Strand+
Gene length (bp)7074
Transcript length (bp)6837
Coding sequence length (bp)6837
Protein length (aa) 2279

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF14765 PS-DH Polyketide synthase dehydratase 7.9E-54 820 1126
PF08659 KR KR domain 1.5E-52 1901 2078
PF00109 ketoacyl-synt Beta-ketoacyl synthase, N-terminal domain 7.7E-52 1 165
PF00698 Acyl_transf_1 Acyl transferase domain 7.2E-40 465 711
PF02801 Ketoacyl-synt_C Beta-ketoacyl synthase, C-terminal domain 3.6E-34 174 290
PF13602 ADH_zinc_N_2 Zinc-binding dehydrogenase 3.1E-18 1743 1880
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 1.3E-16 1705 1833
PF16197 KAsynt_C_assoc Ketoacyl-synthetase C-terminal extension 1.8E-14 293 398
PF00106 adh_short short chain dehydrogenase 4.0E-13 1904 2060
PF13561 adh_short_C2 Enoyl-(Acyl carrier protein) reductase 8.5E-09 1910 2054
PF00550 PP-binding Phosphopantetheine attachment site 3.9E-05 2204 2258
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 2.8E-05 1588 1642

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1108 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 1175 4.0E-162
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1134 7.0E-161
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1073 1.0E-149
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1073 1.0E-148
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1 1108 0.0E+00
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1 1175 4.0E-162
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1 1134 7.0E-161
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1 1073 1.0E-149
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1 1073 1.0E-148
sp|Q9Y7D5|LOVF_ASPTE Lovastatin diketide synthase LovF OS=Aspergillus terreus GN=lovF PE=1 SV=1 1268 2268 1.0E-110
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1 1121 2.0E-107
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1 1121 2.0E-107
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1 1121 2.0E-107
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1 1121 2.0E-107
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1 1121 1.0E-106
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1 1121 2.0E-106
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1 1076 1.0E-105
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1 1076 1.0E-105
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1 1076 7.0E-105
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1 1044 5.0E-104
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1 1044 5.0E-104
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1 1048 1.0E-103
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1 871 3.0E-102
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 802 2.0E-99
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1 1125 3.0E-99
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1 910 6.0E-99
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1 1048 2.0E-98
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1 1067 2.0E-97
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1 1125 4.0E-97
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 802 6.0E-97
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 1046 3.0E-96
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1 802 3.0E-96
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1 683 2.0E-95
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1 683 3.0E-95
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1 806 7.0E-95
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1 683 1.0E-94
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1 1140 4.0E-93
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1 724 3.0E-92
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1 1073 3.0E-92
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1 1030 5.0E-92
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1 752 1.0E-91
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1 752 1.0E-91
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1 752 1.0E-91
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1 874 2.0E-91
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1 881 2.0E-90
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1 792 4.0E-90
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1 880 2.0E-89
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1 875 3.0E-89
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1 1067 9.0E-89
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1 1030 2.0E-88
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1 1126 2.0E-88
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1 875 2.0E-88
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1 1030 1.0E-87
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1 865 8.0E-87
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1 875 4.0E-86
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1 864 9.0E-86
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1 1050 1.0E-85
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1 889 2.0E-85
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1 1048 2.0E-85
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1 1030 4.0E-85
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1 738 5.0E-85
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1 864 1.0E-84
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1 901 1.0E-84
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1 901 5.0E-84
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 1 679 1.0E-82
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1 1049 2.0E-82
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1 901 6.0E-82
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1 699 9.0E-82
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1 901 1.0E-81
sp|B0G103|PKS10_DICDI Probable polyketide synthase 10 OS=Dictyostelium discoideum GN=pks10 PE=3 SV=1 1 865 2.0E-81
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1 901 2.0E-81
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1 889 6.0E-81
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1 901 2.0E-80
sp|Q7TXL6|PPSE_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsE PE=1 SV=1 1 689 4.0E-80
sp|P9WQE1|PPSE_MYCTU Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsE PE=1 SV=1 1 689 4.0E-80
sp|P9WQE0|PPSE_MYCTO Phthiocerol synthesis polyketide synthase type I PpsE OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsE PE=3 SV=1 1 689 4.0E-80
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1 655 5.0E-80
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 2 700 2.0E-79
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1 889 5.0E-79
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 1 679 6.0E-77
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1 666 2.0E-76
sp|P96284|PKS15_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks15 PE=1 SV=2 1 337 3.0E-75
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1 666 4.0E-75
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 444 2.0E-69
sp|P96202|PPSC_MYCTU Phthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsC PE=1 SV=2 1560 2268 2.0E-68
sp|Q7TXL8|PPSC_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsC OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsC PE=1 SV=1 1560 2268 2.0E-68
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 444 5.0E-65
sp|Q03132|ERYA2_SACER Erythronolide synthase, modules 3 and 4 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=3 1547 2254 3.0E-63
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1 337 7.0E-63
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1 337 1.0E-62
sp|P19096|FAS_MOUSE Fatty acid synthase OS=Mus musculus GN=Fasn PE=1 SV=2 1594 2085 2.0E-61
sp|P12785|FAS_RAT Fatty acid synthase OS=Rattus norvegicus GN=Fasn PE=1 SV=3 1594 2085 1.0E-60
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 339 2.0E-60
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 1 444 2.0E-60
sp|Q02251|MCAS_MYCBO Mycocerosic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mas PE=1 SV=2 1584 2087 3.0E-60
sp|P9WQE9|PHAS_MYCTU Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks2 PE=1 SV=1 1584 2238 3.0E-59
sp|P9WQE8|PHAS_MYCTO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=pks2 PE=3 SV=1 1584 2238 3.0E-59
sp|A5U9F4|PHAS_MYCTA Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=pks2 PE=3 SV=1 1584 2238 3.0E-59
sp|Q7TVK8|PHAS_MYCBO Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks2 PE=3 SV=1 1584 2238 3.0E-59
sp|A1KQG0|PHAS_MYCBP Phthioceranic/hydroxyphthioceranic acid synthase OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=pks2 PE=3 SV=1 1584 2238 3.0E-59
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 359 1.0E-58
sp|Q55E72|PKS1_DICDI Probable polyketide synthase 1 OS=Dictyostelium discoideum GN=stlA PE=1 SV=1 1585 2268 3.0E-58
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 445 4.0E-58
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 444 5.0E-58
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1 339 4.0E-57
sp|P36189|FAS_ANSAN Fatty acid synthase (Fragment) OS=Anser anser anser GN=FASN PE=1 SV=1 1 283 1.0E-56
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 339 3.0E-56
sp|P49327|FAS_HUMAN Fatty acid synthase OS=Homo sapiens GN=FASN PE=1 SV=3 1593 2090 4.0E-56
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 1561 2269 7.0E-56
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 444 9.0E-56
sp|Q7TXK8|MSL7_MYCBO Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=pks15/1 PE=1 SV=1 1561 2269 1.0E-55
sp|P12276|FAS_CHICK Fatty acid synthase OS=Gallus gallus GN=FASN PE=1 SV=5 1594 2087 3.0E-55
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 1637 2091 2.0E-54
sp|B2HIL7|MSL7_MYCMM Phenolphthiocerol synthesis polyketide synthase type I Pks15/1 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=pks15/1 PE=1 SV=1 1561 2238 3.0E-54
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1 337 2.0E-53
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1 446 6.0E-53
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1 330 9.0E-53
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1 338 2.0E-52
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 338 8.0E-52
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 1586 2093 8.0E-48
sp|Q869X2|PKS17_DICDI Probable polyketide synthase 17 OS=Dictyostelium discoideum GN=pks17 PE=3 SV=1 1590 2246 5.0E-45
sp|Q869W9|PKS16_DICDI Probable polyketide synthase 16 OS=Dictyostelium discoideum GN=pks16 PE=2 SV=1 1583 2246 5.0E-44
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1 339 6.0E-44
sp|Q54FQ2|PKS30_DICDI Probable polyketide synthase 30 OS=Dictyostelium discoideum GN=pks30 PE=3 SV=1 1585 2270 4.0E-40
sp|Q54FQ1|PKS31_DICDI Probable polyketide synthase 31 OS=Dictyostelium discoideum GN=pks31 PE=3 SV=1 1583 2270 1.0E-39
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1 338 1.0E-39
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 1 444 1.0E-39
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 1583 2270 7.0E-39
sp|Q05470|PKSL_BACSU Polyketide synthase PksL OS=Bacillus subtilis (strain 168) GN=pksL PE=1 SV=3 1 338 1.0E-38
sp|Q54FN7|PKS33_DICDI Probable polyketide synthase 33 OS=Dictyostelium discoideum GN=pks33 PE=3 SV=2 1583 2270 2.0E-38
sp|Q54FP8|PKS32_DICDI Probable polyketide synthase 32 OS=Dictyostelium discoideum GN=pks32 PE=3 SV=1 1583 2270 2.0E-38
sp|Q54FN2|PKS34_DICDI Probable polyketide synthase 34 OS=Dictyostelium discoideum GN=pks34 PE=3 SV=1 1585 2270 5.0E-38
sp|Q54FC8|PKS39_DICDI Probable polyketide synthase 39 OS=Dictyostelium discoideum GN=pks39 PE=3 SV=1 1583 2270 6.0E-37
sp|B0G170|PKS28_DICDI Probable polyketide synthase 28 OS=Dictyostelium discoideum GN=pks28 PE=3 SV=1 1582 2252 5.0E-35
sp|Q54IX3|PKS26_DICDI Probable polyketide synthase 26 OS=Dictyostelium discoideum GN=pks26 PE=3 SV=1 1585 2246 3.0E-34
sp|Q54FD2|PKS38_DICDI Probable polyketide synthase 38 OS=Dictyostelium discoideum GN=pks38 PE=3 SV=1 1583 2270 3.0E-34
sp|Q55CN6|PKS3_DICDI Probable polyketide synthase 3 OS=Dictyostelium discoideum GN=pks3 PE=3 SV=1 1582 2263 1.0E-33
sp|Q54KU3|PKS25_DICDI Probable polyketide synthase 25 OS=Dictyostelium discoideum GN=pks25 PE=3 SV=1 1589 2268 1.0E-33
sp|Q54B49|PKS45_DICDI Probable polyketide synthase 45 OS=Dictyostelium discoideum GN=pks45 PE=3 SV=2 1585 2269 3.0E-33
sp|Q54G30|PKS27_DICDI Probable polyketide synthase 27 OS=Dictyostelium discoideum GN=pks27 PE=3 SV=1 1585 2252 3.0E-33
sp|Q54TW0|PKS18_DICDI Probable polyketide synthase 18 OS=Dictyostelium discoideum GN=pks18 PE=2 SV=1 1585 2246 6.0E-33
sp|Q54B51|PKS44_DICDI Probable polyketide synthase 44 OS=Dictyostelium discoideum GN=pks44 PE=3 SV=1 1585 2269 9.0E-33
sp|Q4WAZ9|NRP14_ASPFU Nonribosomal peptide synthetase 14 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS14 PE=2 SV=2 1833 2270 1.0E-31
sp|Q558Y6|PKS14_DICDI Probable polyketide synthase 14 OS=Dictyostelium discoideum GN=pks14 PE=3 SV=2 1583 2263 5.0E-31
sp|Q54KU5|PKS24_DICDI Probable polyketide synthase 24 OS=Dictyostelium discoideum GN=pks24 PE=3 SV=1 1580 2244 1.0E-30
sp|Q55DM7|PKS2_DICDI Probable polyketide synthase 2 OS=Dictyostelium discoideum GN=pks2 PE=3 SV=1 1530 2276 3.0E-29
sp|Q9Y8A5|LNKS_ASPTE Lovastatin nonaketide synthase OS=Aspergillus terreus GN=lovB PE=1 SV=1 1897 2270 1.0E-27
sp|Q54ED7|PKS40_DICDI Probable polyketide synthase 40 OS=Dictyostelium discoideum GN=pks40 PE=3 SV=1 1585 1888 1.0E-27
sp|Q54ED6|PKS41_DICDI Probable polyketide synthase 41 OS=Dictyostelium discoideum GN=pks41 PE=3 SV=1 1585 1888 2.0E-27
sp|B0G0Z9|PKS6_DICDI Probable polyketide synthase 6 OS=Dictyostelium discoideum GN=pks6 PE=3 SV=1 1585 2262 2.0E-26
sp|Q0C8M3|LNKS_ASPTN Lovastatin nonaketide synthase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=lovB PE=3 SV=2 1897 2270 4.0E-26
sp|B0G101|PKS8_DICDI Probable polyketide synthase 8/35 OS=Dictyostelium discoideum GN=pks8 PE=3 SV=1 1585 2262 4.0E-26
sp|P06230|NODE_RHIME Nodulation protein E OS=Rhizobium meliloti (strain 1021) GN=nodE PE=3 SV=1 1 333 4.0E-26
sp|Q54QD3|PKS22_DICDI Probable polyketide synthase 22 OS=Dictyostelium discoideum GN=pks22 PE=3 SV=1 1576 2241 1.0E-25
sp|P06231|NOE4_RHIML Nodulation protein E OS=Rhizobium meliloti GN=nodE PE=3 SV=1 1 333 1.0E-25
sp|Q54QD1|PKS23_DICDI Probable polyketide synthase 23 OS=Dictyostelium discoideum GN=pks23 PE=3 SV=1 1576 2241 2.0E-25
sp|Q54D44|PKS42_DICDI Probable polyketide synthase 42 OS=Dictyostelium discoideum GN=pks42 PE=3 SV=2 1583 2087 2.0E-25
sp|P96285|PKS1_MYCTU Putative inactive phenolphthiocerol synthesis polyketide synthase type I Pks1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks1 PE=1 SV=4 414 871 3.0E-25
sp|Q559A9|PKS13_DICDI Probable polyketide synthase 13 OS=Dictyostelium discoideum GN=pks13 PE=3 SV=1 1582 2086 5.0E-25
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 462 802 6.0E-25
sp|Q9HCJ6|VAT1L_HUMAN Synaptic vesicle membrane protein VAT-1 homolog-like OS=Homo sapiens GN=VAT1L PE=1 SV=2 1587 1880 1.0E-24
sp|Q80TB8|VAT1L_MOUSE Synaptic vesicle membrane protein VAT-1 homolog-like OS=Mus musculus GN=Vat1l PE=1 SV=2 1529 1880 2.0E-24
sp|B0G100|PKS7_DICDI Probable polyketide synthase 7 OS=Dictyostelium discoideum GN=pks7 PE=3 SV=1 1585 2262 3.0E-24
sp|P04684|NODE_RHILT Nodulation protein E OS=Rhizobium leguminosarum bv. trifolii GN=nodE PE=3 SV=2 42 333 6.0E-24
sp|P72331|NODE_RHIS3 Nodulation protein E OS=Rhizobium sp. (strain N33) GN=nodE PE=3 SV=1 1 300 8.0E-24
sp|Q86AE3|PKS9_DICDI Probable polyketide synthase 9/36 OS=Dictyostelium discoideum GN=pks9 PE=2 SV=1 1585 2263 1.0E-23
sp|Q86JI5|PKS5_DICDI Probable polyketide synthase 5 OS=Dictyostelium discoideum GN=pks5 PE=2 SV=1 1585 2263 1.0E-23
sp|Q71SP7|FAS_BOVIN Fatty acid synthase OS=Bos taurus GN=FASN PE=2 SV=1 463 912 2.0E-23
sp|Q59I44|CAA43_BURSP 2-haloacrylate reductase OS=Burkholderia sp. GN=caa43 PE=1 SV=1 1577 1880 3.0E-23
sp|P04683|NODE_RHILV Nodulation protein E OS=Rhizobium leguminosarum bv. viciae GN=nodE PE=3 SV=2 42 333 3.0E-23
sp|B0G138|PKS21_DICDI Probable polyketide synthase 21 OS=Dictyostelium discoideum GN=pks21 PE=3 SV=1 1569 1880 8.0E-23
sp|Q54T36|PKS19_DICDI Probable polyketide synthase 19 OS=Dictyostelium discoideum GN=pks19 PE=3 SV=1 1569 1880 2.0E-22
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 1583 1876 3.0E-22
sp|Q83E37|FABF_COXBU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=fabF PE=1 SV=1 9 337 8.0E-22
sp|Q8JFV8|VAT1_DANRE Synaptic vesicle membrane protein VAT-1 homolog OS=Danio rerio GN=vat1 PE=2 SV=1 1585 1881 2.0E-21
sp|O34340|FABF_BACSU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Bacillus subtilis (strain 168) GN=fabF PE=1 SV=1 66 337 6.0E-21
sp|A1CLY8|CCSA_ASPCL Polyketide synthase-nonribosomal peptide synthetase OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ccsA PE=3 SV=1 1924 2261 8.0E-21
sp|P11415|QOR_CAVPO Quinone oxidoreductase OS=Cavia porcellus GN=CRYZ PE=1 SV=1 1584 1880 8.0E-21
sp|Q08257|QOR_HUMAN Quinone oxidoreductase OS=Homo sapiens GN=CRYZ PE=1 SV=1 1584 1880 2.0E-20
sp|Q9D404|OXSM_MOUSE 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Mus musculus GN=Oxsm PE=1 SV=1 50 337 2.0E-20
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN=Cryz PE=2 SV=1 1589 1880 2.0E-20
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz PE=1 SV=1 1589 1880 2.0E-20
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=qor PE=3 SV=2 1569 1795 2.0E-20
sp|O97764|QOR_BOVIN Zeta-crystallin OS=Bos taurus GN=CRYZ PE=2 SV=2 1562 1883 5.0E-20
sp|Q5R4S7|QOR_PONAB Quinone oxidoreductase OS=Pongo abelii GN=CRYZ PE=2 SV=1 1562 1880 5.0E-20
sp|P28304|QOR1_ECOLI Quinone oxidoreductase 1 OS=Escherichia coli (strain K12) GN=qorA PE=1 SV=1 1569 1795 7.0E-20
sp|Q54FQ3|PKS29_DICDI Probable polyketide synthase 29 OS=Dictyostelium discoideum GN=pks29 PE=3 SV=1 428 901 8.0E-20
sp|Q8L3X9|KASM_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Arabidopsis thaliana GN=KAS PE=1 SV=1 66 337 9.0E-20
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2 SV=1 1587 1795 2.0E-19
sp|P56902|FABF_RHIME 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Rhizobium meliloti (strain 1021) GN=fabF PE=3 SV=2 66 337 2.0E-19
sp|P52410|KASC1_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Arabidopsis thaliana GN=KAS1 PE=2 SV=2 76 335 8.0E-19
sp|Q558W4|PKS15_DICDI Probable polyketide synthase 15 OS=Dictyostelium discoideum GN=pks15 PE=3 SV=2 458 690 1.0E-18
sp|Q54FI3|PKS37_DICDI Probable polyketide synthase 37 OS=Dictyostelium discoideum GN=stlB PE=2 SV=1 463 1080 1.0E-18
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=qor PE=3 SV=2 1583 1795 1.0E-18
sp|P23155|KAS1_STRCO Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5318 PE=3 SV=1 67 337 2.0E-18
sp|Q9KQH9|FABF_VIBCH 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=fabF PE=1 SV=3 14 337 2.0E-18
sp|P0AAI8|FABF_SHIFL 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Shigella flexneri GN=fabF PE=3 SV=2 73 337 3.0E-18
sp|P0AAI5|FABF_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli (strain K12) GN=fabF PE=1 SV=2 73 337 3.0E-18
sp|P0AAI6|FABF_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabF PE=3 SV=2 73 337 3.0E-18
sp|P0AAI7|FABF_ECO57 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Escherichia coli O157:H7 GN=fabF PE=3 SV=2 73 337 3.0E-18
sp|Q99536|VAT1_HUMAN Synaptic vesicle membrane protein VAT-1 homolog OS=Homo sapiens GN=VAT1 PE=1 SV=2 1589 1881 5.0E-18
sp|P55338|FABF_VIBHA 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Vibrio harveyi GN=fabF PE=3 SV=2 9 342 5.0E-18
sp|Q28452|QOR_LAMGU Quinone oxidoreductase OS=Lama guanicoe GN=CRYZ PE=2 SV=1 1587 1797 7.0E-18
sp|P43710|FABB_HAEIN 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabB PE=3 SV=1 14 337 8.0E-18
sp|Q05356|KAS1_STRHA Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces halstedii GN=sch1 PE=3 SV=1 70 337 9.0E-18
sp|Q9NWU1|OXSM_HUMAN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Homo sapiens GN=OXSM PE=1 SV=1 66 337 1.0E-17
sp|Q5TKS0|FABF_STAAU 3-oxoacyl-[acyl-carrier-protein] synthase 2 (Fragment) OS=Staphylococcus aureus GN=fabF PE=3 SV=1 66 337 1.0E-17
sp|P23902|KASC1_HORVU 3-oxoacyl-[acyl-carrier-protein] synthase I, chloroplastic OS=Hordeum vulgare GN=KAS12 PE=1 SV=1 76 337 2.0E-17
sp|Q6GIA3|FABF_STAAR 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MRSA252) GN=fabF PE=3 SV=1 66 337 2.0E-17
sp|Q7A6F8|FABF_STAAN 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain N315) GN=fabF PE=1 SV=1 66 337 2.0E-17
sp|Q99VA6|FABF_STAAM 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabF PE=3 SV=1 66 337 2.0E-17
sp|Q8NXE1|FABF_STAAW 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MW2) GN=fabF PE=1 SV=1 66 337 3.0E-17
sp|Q6GAU2|FABF_STAAS 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain MSSA476) GN=fabF PE=3 SV=1 66 337 3.0E-17
sp|Q5HHA1|FABF_STAAC 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Staphylococcus aureus (strain COL) GN=fabF PE=1 SV=1 66 337 3.0E-17
sp|Q0VCA7|OXSM_BOVIN 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Bos taurus GN=OXSM PE=2 SV=1 66 337 3.0E-17
sp|Q02059|KASA_STRCO Actinorhodin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=SCO5087 PE=1 SV=2 1 340 4.0E-17
sp|Q02K94|FABB_PSEAB 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=fabB PE=1 SV=1 13 337 5.0E-17
sp|O94297|OXSM_SCHPO Putative 3-oxoacyl-[acyl-carrier-protein] synthase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.13c PE=3 SV=1 70 337 1.0E-16
sp|P73242|FABD_SYNY3 Malonyl CoA-acyl carrier protein transacylase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabD PE=1 SV=1 462 744 3.0E-16
sp|Q9C9P4|KASC2_ARATH 3-oxoacyl-[acyl-carrier-protein] synthase II, chloroplastic OS=Arabidopsis thaliana GN=KAS2 PE=1 SV=1 78 337 3.0E-16
sp|P19333|VAT1_TORCA Synaptic vesicle membrane protein VAT-1 OS=Torpedo californica PE=1 SV=1 1585 1892 4.0E-16
sp|Q02578|KAS1_STRCN Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cyaneus GN=curA PE=3 SV=1 70 337 5.0E-16
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 420 771 8.0E-16
sp|P41175|KAS1_STRCM Putative polyketide beta-ketoacyl synthase 1 OS=Streptomyces cinnamonensis PE=3 SV=1 78 340 1.0E-15
sp|A7RK30|QORL2_NEMVE Quinone oxidoreductase-like protein 2 homolog OS=Nematostella vectensis GN=v1g238856 PE=3 SV=1 1578 1881 2.0E-15
sp|Q3MIE4|VAT1_RAT Synaptic vesicle membrane protein VAT-1 homolog OS=Rattus norvegicus GN=Vat1 PE=1 SV=1 1589 1881 4.0E-15
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1901 2238 7.0E-15
sp|B4XYB8|AZIB_STREG 5-methyl-1-naphthoate synthase OS=Streptomyces sahachiroi GN=aziB PE=1 SV=1 1889 2071 1.0E-14
sp|P0A953|FABB_ECOLI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli (strain K12) GN=fabB PE=1 SV=1 13 337 1.0E-14
sp|P0A954|FABB_ECOL6 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabB PE=3 SV=1 13 337 1.0E-14
sp|Q62465|VAT1_MOUSE Synaptic vesicle membrane protein VAT-1 homolog OS=Mus musculus GN=Vat1 PE=1 SV=3 1589 1881 4.0E-14
sp|P16540|KAS1_STRVN Granaticin polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces violaceoruber GN=gra-orf1 PE=3 SV=1 1 337 7.0E-14
sp|P9WQD7|FAB2_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasB PE=1 SV=1 85 335 8.0E-14
sp|P9WQD6|FAB2_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasB PE=3 SV=1 85 335 8.0E-14
sp|P63457|FAB2_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasB PE=3 SV=1 85 335 8.0E-14
sp|Q53FA7|QORX_HUMAN Quinone oxidoreductase PIG3 OS=Homo sapiens GN=TP53I3 PE=1 SV=2 1586 1882 1.0E-13
sp|O69473|FAB2_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Mycobacterium leprae (strain TN) GN=kasB PE=3 SV=2 85 335 3.0E-13
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1900 2087 4.0E-13
sp|P16538|KAS1_STRGA Tetracenomycin C polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces glaucescens GN=tcmK PE=3 SV=1 78 337 4.0E-13
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZTA1 PE=1 SV=1 1556 1880 6.0E-13
sp|P57193|FABB_BUCAI 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=fabB PE=3 SV=1 56 337 8.0E-13
sp|P39525|CEM1_YEAST 3-oxoacyl-[acyl-carrier-protein] synthase homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CEM1 PE=1 SV=1 66 337 9.0E-13
sp|P22367|MSAS_PENPA 6-methylsalicylic acid synthase OS=Penicillium patulum PE=1 SV=1 1901 2238 3.0E-12
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1916 2093 1.0E-11
sp|O34877|PKSD_BACSU Polyketide biosynthesis acyltransferase homolog PksD OS=Bacillus subtilis (strain 168) GN=pksD PE=1 SV=2 463 700 1.0E-11
sp|Q89AY4|FABB_BUCBP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=fabB PE=3 SV=1 56 337 1.0E-11
sp|Q8BGC4|ZADH2_MOUSE Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Mus musculus GN=Zadh2 PE=1 SV=1 1586 1880 2.0E-11
sp|A7Z4Y0|BAEE_BACMF Polyketide biosynthesis protein BaeE OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeE PE=1 SV=1 463 734 2.0E-11
sp|A7Z4X9|BAED_BACMF Polyketide biosynthesis acyltransferase homolog BaeD OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=baeD PE=1 SV=1 463 682 2.0E-11
sp|P73283|FABF_SYNY3 3-oxoacyl-[acyl-carrier-protein] synthase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=fabF PE=1 SV=1 77 332 2.0E-11
sp|Q03131|ERYA1_SACER Erythronolide synthase, modules 1 and 2 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=1 1901 2238 5.0E-11
sp|P71019|FABD_BACSU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis (strain 168) GN=fabD PE=3 SV=2 462 680 7.0E-11
sp|Q8N4Q0|ZADH2_HUMAN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Homo sapiens GN=ZADH2 PE=1 SV=1 1586 1796 9.0E-11
sp|Q24K16|ZADH2_BOVIN Zinc-binding alcohol dehydrogenase domain-containing protein 2 OS=Bos taurus GN=ZADH2 PE=2 SV=1 1586 1895 9.0E-11
sp|P40804|PKSF_BACSU Polyketide biosynthesis malonyl-ACP decarboxylase PksF OS=Bacillus subtilis (strain 168) GN=pksF PE=1 SV=3 74 339 1.0E-10
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1901 2270 2.0E-10
sp|Q9PKF7|FABG_CHLMU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia muridarum (strain MoPn / Nigg) GN=fabG PE=3 SV=1 1904 2121 2.0E-10
sp|Q3UNZ8|QORL2_MOUSE Quinone oxidoreductase-like protein 2 OS=Mus musculus PE=1 SV=1 1580 1882 2.0E-10
sp|Q9R9J2|FENF_BACIU Malonyl CoA-acyl carrier protein transacylase OS=Bacillus subtilis GN=fenF PE=1 SV=1 462 726 4.0E-10
sp|B0BNC9|QORL2_RAT Quinone oxidoreductase-like protein 2 OS=Rattus norvegicus PE=2 SV=1 1580 1882 4.0E-10
sp|Q6G9Y3|FABD_STAAS Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MSSA476) GN=fabD PE=3 SV=1 462 743 7.0E-10
sp|P38004|FABG_CHLTR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=fabG PE=3 SV=3 1896 2053 7.0E-10
sp|P43678|KAS1_STRRM Oxytetracycline polyketide putative beta-ketoacyl synthase 1 OS=Streptomyces rimosus PE=3 SV=2 64 337 8.0E-10
sp|Q8KA28|FABB_BUCAP 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabB PE=3 SV=1 58 337 9.0E-10
sp|Q7A124|FABD_STAAW Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MW2) GN=fabD PE=3 SV=1 462 743 1.0E-09
sp|Q93QD4|FABD_STAAU Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus GN=fabD PE=3 SV=1 462 743 1.0E-09
sp|Q7A5Z3|FABD_STAAN Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain N315) GN=fabD PE=1 SV=1 462 743 1.0E-09
sp|Q99UN8|FABD_STAAM Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabD PE=1 SV=1 462 743 1.0E-09
sp|Q5HGK3|FABD_STAAC Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain COL) GN=fabD PE=3 SV=1 462 743 1.0E-09
sp|Q9CBS7|FAB1_MYCLE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium leprae (strain TN) GN=kasA PE=3 SV=1 85 332 1.0E-09
sp|Q6GHK5|FABD_STAAR Malonyl CoA-acyl carrier protein transacylase OS=Staphylococcus aureus (strain MRSA252) GN=fabD PE=3 SV=1 462 743 1.0E-09
sp|P50205|PHBB_RHIME Acetoacetyl-CoA reductase OS=Rhizobium meliloti (strain 1021) GN=phbB PE=3 SV=1 1904 2066 1.0E-09
sp|P23238|PHBB_ZOORA Acetoacetyl-CoA reductase OS=Zoogloea ramigera GN=phbB PE=3 SV=1 1904 2066 2.0E-09
sp|P9WQD9|FAB1_MYCTU 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kasA PE=1 SV=1 85 332 2.0E-09
sp|P9WQD8|FAB1_MYCTO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kasA PE=3 SV=1 85 332 2.0E-09
sp|H8ESN0|FAB1_MYCTE 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium tuberculosis (strain ATCC 35801 / TMC 107 / Erdman) GN=kasA PE=2 SV=2 85 332 2.0E-09
sp|P63455|FAB1_MYCBO 3-oxoacyl-[acyl-carrier-protein] synthase 1 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kasA PE=3 SV=1 85 332 2.0E-09
sp|P42865|QOR_LEIAM Probable quinone oxidoreductase OS=Leishmania amazonensis PE=3 SV=1 1583 1795 2.0E-09
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zta1 PE=1 SV=2 1597 1795 2.0E-09
sp|P9WQE5|PPSB_MYCTU Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsB PE=1 SV=1 1862 2080 5.0E-09
sp|P9WQE4|PPSB_MYCTO Phthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsB PE=3 SV=1 1862 2080 5.0E-09
sp|P51831|FABG_BACSU 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Bacillus subtilis (strain 168) GN=fabG PE=3 SV=3 1904 2060 5.0E-09
sp|P50204|PHAB_PARDE Acetoacetyl-CoA reductase OS=Paracoccus denitrificans GN=phaB PE=3 SV=1 1904 2069 6.0E-09
sp|Q7TXL9|PPSB_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsB PE=1 SV=1 1862 2080 1.0E-08
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 1897 2090 2.0E-08
sp|P17611|NODG_AZOBR Nodulation protein G OS=Azospirillum brasilense GN=nodG PE=3 SV=2 1904 2073 2.0E-08
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 1583 1883 2.0E-08
sp|P9WQE7|PPSA_MYCTU Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsA PE=1 SV=1 1945 2091 4.0E-08
sp|O42909|YBI2_SCHPO Zinc-type alcohol dehydrogenase-like protein C16A3.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC16A3.02c PE=3 SV=1 1585 1735 4.0E-08
sp|P9WQE6|PPSA_MYCTO Phthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsA PE=3 SV=1 1945 2091 5.0E-08
sp|Q7TXM0|PPSA_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsA PE=1 SV=1 1945 2091 5.0E-08
sp|P97852|DHB4_RAT Peroxisomal multifunctional enzyme type 2 OS=Rattus norvegicus GN=Hsd17b4 PE=1 SV=3 1904 2068 6.0E-08
sp|A6QQF5|QORL2_BOVIN Quinone oxidoreductase-like protein 2 OS=Bos taurus PE=2 SV=2 1584 1796 7.0E-08
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 1589 1736 7.0E-08
sp|O34825|PKSC_BACSU Polyketide biosynthesis malonyl CoA-acyl carrier protein transacylase PksC OS=Bacillus subtilis (strain 168) GN=pksC PE=1 SV=1 463 737 8.0E-08
sp|P96825|Y0148_MYCTU Putative short-chain type dehydrogenase/reductase Rv0148 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv0148 PE=1 SV=3 1904 2051 9.0E-08
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 1904 2060 1.0E-07
sp|O54438|FABG_PSEAE 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fabG PE=1 SV=1 1904 2073 1.0E-07
sp|Q8X8I7|FABD_ECO57 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O157:H7 GN=fabD PE=3 SV=3 462 642 1.0E-07
sp|P0A0I0|FABG_STAAW 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MW2) GN=fabG PE=3 SV=1 1897 2060 1.0E-07
sp|Q6G9Y2|FABG_STAAS 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MSSA476) GN=fabG PE=3 SV=1 1897 2060 1.0E-07
sp|Q6GHK4|FABG_STAAR 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain MRSA252) GN=fabG PE=3 SV=1 1897 2060 1.0E-07
sp|P99093|FABG_STAAN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain N315) GN=fabG PE=1 SV=1 1897 2060 1.0E-07
sp|P0A0H9|FABG_STAAM 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=fabG PE=1 SV=1 1897 2060 1.0E-07
sp|Q5HGK2|FABG_STAAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Staphylococcus aureus (strain COL) GN=fabG PE=3 SV=2 1897 2060 1.0E-07
sp|P34055|INC11_HYPAT Protein indc11 OS=Hypocrea atroviridis GN=indc11 PE=2 SV=1 1582 1821 2.0E-07
sp|P51660|DHB4_MOUSE Peroxisomal multifunctional enzyme type 2 OS=Mus musculus GN=Hsd17b4 PE=1 SV=3 1904 2068 2.0E-07
sp|P51659|DHB4_HUMAN Peroxisomal multifunctional enzyme type 2 OS=Homo sapiens GN=HSD17B4 PE=1 SV=3 1897 2069 2.0E-07
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 1585 1880 3.0E-07
sp|Q9C0Y6|YKM8_SCHPO Zinc-type alcohol dehydrogenase-like protein PB24D3.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.08c PE=3 SV=1 1611 1778 3.0E-07
sp|P43712|FABD_HAEIN Malonyl CoA-acyl carrier protein transacylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fabD PE=3 SV=1 462 737 3.0E-07
sp|Q03133|ERYA3_SACER Erythronolide synthase, modules 5 and 6 OS=Saccharopolyspora erythraea GN=eryA PE=1 SV=4 1900 2075 5.0E-07
sp|A0R0B2|FABD_MYCS2 Malonyl CoA-acyl carrier protein transacylase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=fabD PE=1 SV=1 541 703 5.0E-07
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 1589 1736 5.0E-07
sp|P40872|PKSM_BACSU Polyketide synthase PksM OS=Bacillus subtilis (strain 168) GN=pksM PE=1 SV=4 845 1204 6.0E-07
sp|P45375|PHBB_ALLVD Acetoacetyl-CoA reductase OS=Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D) GN=phbB PE=3 SV=2 1947 2084 6.0E-07
sp|P9WQE3|PPSD_MYCTU Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ppsD PE=1 SV=1 1917 2082 9.0E-07
sp|P9WQE2|PPSD_MYCTO Phthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ppsD PE=3 SV=1 1917 2082 9.0E-07
sp|Q7TXL7|PPSD_MYCBO Phthiocerol/phenolphthiocerol synthesis polyketide synthase type I PpsD OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ppsD PE=3 SV=1 1917 2082 1.0E-06
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1917 2238 1.0E-06
sp|P0AAI9|FABD_ECOLI Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli (strain K12) GN=fabD PE=1 SV=2 462 642 1.0E-06
sp|P0AAJ0|FABD_ECOL6 Malonyl CoA-acyl carrier protein transacylase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fabD PE=3 SV=2 462 642 1.0E-06
sp|P28643|FABG_CUPLA 3-oxoacyl-[acyl-carrier-protein] reductase, chloroplastic OS=Cuphea lanceolata GN=CLKR27 PE=2 SV=1 1904 2053 2.0E-06
sp|Q00681|STCJ_EMENI Sterigmatocystin biosynthesis fatty acid synthase subunit alpha OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcJ PE=3 SV=2 78 336 2.0E-06
sp|P72332|NODG_RHIS3 Nodulation protein G OS=Rhizobium sp. (strain N33) GN=nodG PE=3 SV=1 1904 2073 3.0E-06
sp|Q8K9J6|FABD_BUCAP Malonyl CoA-acyl carrier protein transacylase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=fabD PE=3 SV=1 463 686 3.0E-06
sp|Q9X248|FABG_THEMA 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=fabG PE=3 SV=1 1904 2060 3.0E-06
sp|P70720|FABG_AGGAC 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Aggregatibacter actinomycetemcomitans GN=fabG PE=3 SV=1 1950 2073 4.0E-06
sp|Q07017|OL56_STRAT Oleandomycin polyketide synthase, modules 5 and 6 OS=Streptomyces antibioticus GN=orfB PE=3 SV=1 1917 2092 6.0E-06
sp|O31782|PKSN_BACSU Polyketide synthase PksN OS=Bacillus subtilis (strain 168) GN=pksN PE=1 SV=3 1900 2251 6.0E-06
sp|Q9Z8P2|FABG_CHLPN 3-oxoacyl-[acyl-carrier-protein] reductase FabG OS=Chlamydia pneumoniae GN=fabG PE=3 SV=1 1904 2127 6.0E-06
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 844 1125 7.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

Gene cluster ID Type of secondary metabolism gene
Cluster 5 PKS

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|201
Ophiocordyceps australis 1348a (Ghana) OphauG2|7422
Ophiocordyceps australis 1348a (Ghana) OphauG2|7411
Ophiocordyceps australis 1348a (Ghana) OphauG2|6241
Ophiocordyceps australis 1348a (Ghana) OphauG2|4898
Ophiocordyceps australis 1348a (Ghana) OphauG2|4897
Ophiocordyceps australis 1348a (Ghana) OphauG2|2708
Ophiocordyceps australis 1348a (Ghana) OphauG2|2128
Ophiocordyceps australis 1348a (Ghana) OphauG2|1191
Ophiocordyceps australis 1348a (Ghana) OphauG2|1124 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|4459
Ophiocordyceps australis map64 (Brazil) OphauB2|5387
Ophiocordyceps australis map64 (Brazil) OphauB2|476
Ophiocordyceps australis map64 (Brazil) OphauB2|5635
Ophiocordyceps australis map64 (Brazil) OphauB2|3063
Ophiocordyceps australis map64 (Brazil) OphauB2|5406
Ophiocordyceps australis map64 (Brazil) OphauB2|3017
Ophiocordyceps australis map64 (Brazil) OphauB2|712
Ophiocordyceps australis map64 (Brazil) OphauB2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|1454
Ophiocordyceps australis map64 (Brazil) OphauB2|6068
Ophiocordyceps australis map64 (Brazil) OphauB2|6715
Ophiocordyceps australis map64 (Brazil) OphauB2|5636
Ophiocordyceps australis map64 (Brazil) OphauB2|7340
Ophiocordyceps australis map64 (Brazil) OphauB2|7710
Ophiocordyceps australis map64 (Brazil) OphauB2|2028
Ophiocordyceps australis map64 (Brazil) OphauB2|5805
Ophiocordyceps camponoti-floridani Ophcf2|02942
Ophiocordyceps subramaniannii Hirsu2|8482
Ophiocordyceps subramaniannii Hirsu2|8480
Ophiocordyceps subramaniannii Hirsu2|7800
Ophiocordyceps subramaniannii Hirsu2|7724
Ophiocordyceps subramaniannii Hirsu2|6729
Ophiocordyceps subramaniannii Hirsu2|5683
Ophiocordyceps subramaniannii Hirsu2|5301
Ophiocordyceps subramaniannii Hirsu2|5151
Ophiocordyceps subramaniannii Hirsu2|4977
Ophiocordyceps subramaniannii Hirsu2|4297
Ophiocordyceps subramaniannii Hirsu2|4296
Ophiocordyceps subramaniannii Hirsu2|3325
Ophiocordyceps subramaniannii Hirsu2|26
Ophiocordyceps subramaniannii Hirsu2|25
Ophiocordyceps subramaniannii Hirsu2|9187
Ophiocordyceps subramaniannii Hirsu2|11188

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1124
MDPQHRMLLEVTHQALDSAGLAAHSLAGSRTGVYAAHFTSDYREAIFRDAEAAPLYTNTGTNATSASNRVSHLFD
LRGPSFTVDTACSSSLVACHLACQSLLSRETDTALVGGTSLLLNPDMFLYLSNQKFLSPDGQCKTFDAAGDGYGR
GEGVGVLLLKRVSDAIRHGDPIRAVIRGTGCNQDGHTKGFTIPSVDAQAALIRETYSKAGLDLAQTRYVEAHGTG
TQAGDTREMEGLSRTFSPHRSSADKLLVGSVKTNIGHLEACAGLASLIKSIYILESGIIAPTASVRVPNPKIEWD
QWHLAVPAVPTPWPTPGLRRISTQGFGYGGTNAHVILDDAAHYLQAKGLSGIHYTRTAEPSTRRAPATDQPRLFL
LRAHDGDGLKRVRASLAQHLVQHLDRPNPWPDSATYLHDLAHTLSSRRSQLQWQTFVTAASEAQLVEALGQDSWP
NPELRRAATAPRLAFIFTGQGAQWARMGVDLMAYPVYRQSVLDSDHFLRQTLGCCWSAADELAKPQASSNLSQAA
YSQTLCSVLQIALVDLLEHWNITPTRVAGHSSGEIAAAYCLGALSKHDALRVAYHRGTLSSEMQQTHKHRQGAMM
AVGASAGQVQGYLPRLTRGRVVVACINSPSSVTASGDAAAIDELLDLAQKDGLFARKLQVDVAYHSHHMESVATA
YAQLLANMETQPARPGRSMHSSVLGGPIDASQLGAANWAIDTLVEIGPHSALKGPLQQILKDCGLTGVGYASMLS
RGAHAIKTALACAGELVISGVPAAMGHVNLEADARPVVDLPPYPWNHSAQFWAESRLSQEYRLRKHPRMPLLGSP
CPTMGARERLWRGFMRLDEEPWIRHHEIQGSILYPGAGFLTMAIEAAAQQARDQDASVSAFRLRDVHLDAALVVT
EDSSVEAILQLRPHLPAPGSSTASWLEFTVNSSIDKGPLRQNCSGLIMLEHHADPHSAMGRERALDTDTLCQRFK
QTRQLCRQPVDVPDFYSRLTALGLRYGPSFANVTEIECADQGRCVGAVRIPVLDSMGDNSHVIHPATLDAVFHLA
FAALDGASLSAPMVPTSIQELVIAADTPSTPGTLLRGLSHSEPYGFRELVSDIDMLNEQGTKALIQLKGFRCAAL
STTPTPVADGRPIAFGVSWKPAAALLTSKELQAYISRSAVPCTVSVDSESLDKSPSSSALADMESKGALAALVQP
LDAYIALRRHSKPNLSIVELTAQSVPYSLFAALPSRHSLLQTAHYAIEASAQAARDQIKSQFGPLASEIDITTDV
HDKHDLVLVFDSGLSKAQTEALVQKAAKLLGPGGAIILAELKANEANSWTSSPLSALDLTPPLNLVDSQSQGSKH
FRLCVSDTAPKPNGVKHHEAQQVALIETANPSKLAQAITAAVAQRLQDASISASRLSWPCDVSQLKGRKCIVLAD
LETALLKDPSPADLAAVQSLFSHANQTLWVSGPLGPDAALITGLARTVRNEAVGIQLRTLELADVALTDADACAD
AVCRVFDAHTSDDEFRLVSATLQTSRLVEDEERNEELAQMLGRKEKTPVASKIQEPPQPIKLCVGQVGMLDSVCF
EPDGLALEPLGEDEVEINVKASGVNFRDVMVALGQIPDRNFGFEGAGIVRRVGSAKTGFSVGQRVMFLAHGAHRT
VHRVAADFVVSMPDGLSLVDGAALLLVHTTAWYALVRTARATAGQSVLIHAAAGGVGQALLMLARHLRLEVYATV
GTDEKRKLVRERYGVPDDHIFNSRDLSFVAGIKRMTRGRGVDIIVNSLAGEALRQTWYCLAAFGTFVEVGMKDIL
DNARLDMRPFLRDATFAFFNLNHVQKERPDLMREALRETMALVRAGVLEPATPTTSFPASQAETALRRIQTGQHM
GKLVLTFDTGDMVPVLRPSVGLSASGSYLLVGGLGGLGRSLARLFISLGARNLCFLSRSGAESSGTKAFIHELEA
QAGVKVLVCKADVSHGEHVAQAVQRCTATLGPIQGVVQCAMVLRDGLFERMTHSQWLESTRPKVQGTCNLHHHVP
SSAWLITLSSFSGIFGNRGQSNYAAAGAYQDGLAQLCHAQGRRAVTLDLGIMRDVGVLAEKGITDQLREWEEPFG
IRESELHALVKSAIIATTQPSGRSPAQIPTGLATARSAKAAAISPPFYFDDARFSMLAQTRLDSASSATASSSSP
SDGDKPSVESQLAQVHSVDQAAALVQTVLLERVAKTLQSASSEIDPSRPLHSYGVDSLVAVEMVKWMFKALHAKV
TVFDVLSNVPITALCEKVASVSTLVKID*
Coding >OphauG2|1124
ATGGATCCTCAGCACCGCATGCTGCTCGAAGTCACCCACCAAGCCCTTGACAGCGCCGGCCTCGCCGCCCACAGC
CTCGCCGGCTCGCGTACTGGCGTCTACGCTGCACATTTCACCAGTGATTACCGCGAGGCCATTTTCCGGGATGCA
GAGGCAGCGCCACTGTATACCAATACAGGAACAAACGCCACGTCGGCGTCGAATCGCGTCTCGCACTTGTTCGAC
CTGCGCGGCCCCAGCTTTACCGTCGACACGGCCTGTTCGTCGAGCCTCGTGGCGTGCCATCTCGCGTGCCAGAGC
TTGTTGAGCCGAGAGACGGATACGGCCCTGGTCGGCGGCACCAGCTTGCTGCTCAACCCCGACATGTTTCTCTAC
CTCTCCAACCAAAAGTTCCTCTCGCCAGACGGCCAGTGCAAGACGTTTGACGCTGCAGGCGACGGCTACGGGCGC
GGCGAAGGAGTGGGCGTGCTTCTTCTAAAGCGAGTCAGCGATGCCATTCGCCATGGCGATCCCATCCGAGCCGTC
ATCCGCGGCACCGGGTGCAACCAAGACGGCCATACAAAGGGCTTCACCATTCCCAGCGTCGATGCCCAGGCCGCG
CTGATCCGGGAAACCTACTCCAAGGCCGGCCTCGACCTCGCTCAAACGCGATATGTCGAGGCTCACGGCACCGGC
ACCCAGGCCGGCGACACGCGCGAAATGGAAGGCCTGTCACGCACCTTTAGCCCCCATCGCAGCTCAGCCGACAAA
CTGCTCGTCGGGTCGGTCAAGACAAACATTGGCCATCTCGAGGCTTGTGCGGGCCTGGCCTCGCTCATCAAAAGC
ATCTATATTCTGGAGTCGGGCATCATTGCCCCAACCGCCAGCGTCAGAGTGCCAAATCCCAAGATTGAGTGGGAC
CAATGGCATCTCGCCGTGCCCGCCGTGCCCACGCCCTGGCCCACGCCCGGACTGCGACGCATCAGCACCCAGGGC
TTTGGCTACGGCGGCACCAACGCTCATGTCATCCTCGACGACGCAGCACACTATCTGCAGGCCAAGGGGCTCAGC
GGCATCCACTATACCCGCACCGCCGAGCCGAGCACGCGCCGCGCGCCAGCCACCGACCAGCCGCGCCTCTTTCTG
CTGCGTGCACATGATGGCGACGGCCTCAAGCGTGTCCGCGCCTCGCTCGCCCAGCATCTCGTCCAGCATCTCGAC
CGGCCCAACCCTTGGCCAGACTCGGCCACATATCTGCACGACTTGGCCCATACCCTCTCCAGCCGCCGCTCCCAG
CTCCAGTGGCAGACCTTTGTCACGGCCGCCTCGGAGGCTCAGTTGGTCGAGGCCCTGGGCCAAGACAGCTGGCCC
AACCCCGAGCTGCGCCGCGCCGCCACTGCGCCCCGTCTTGCCTTCATCTTCACCGGCCAGGGCGCTCAGTGGGCG
CGCATGGGCGTCGACCTCATGGCCTACCCCGTCTACCGCCAGAGCGTGCTCGACTCGGACCACTTCCTCCGCCAG
ACGCTCGGGTGCTGCTGGTCGGCGGCCGACGAGCTGGCCAAGCCACAGGCGTCGTCCAACCTGTCCCAGGCAGCA
TACAGCCAGACGCTCTGCTCCGTGCTTCAGATTGCCCTGGTCGACTTGCTCGAGCACTGGAATATCACGCCCACC
CGCGTCGCAGGCCACTCGAGCGGTGAGATTGCCGCCGCCTACTGTCTCGGGGCGCTCAGCAAGCACGACGCCCTG
CGCGTCGCCTACCATCGCGGCACCCTGTCCAGCGAGATGCAGCAGACTCACAAGCATCGCCAGGGCGCCATGATG
GCCGTGGGCGCCTCGGCTGGCCAGGTCCAAGGCTATCTGCCACGTCTGACCCGCGGCCGTGTCGTCGTGGCCTGC
ATCAACTCGCCCTCGAGCGTCACAGCCTCGGGCGACGCCGCCGCCATTGACGAGCTGCTGGACCTGGCGCAGAAA
GACGGCCTCTTTGCGCGCAAGCTTCAGGTCGACGTGGCCTACCACTCGCACCACATGGAGTCTGTTGCCACGGCC
TATGCCCAGCTCCTCGCCAACATGGAGACGCAGCCCGCCCGGCCAGGCCGCTCCATGCACTCGAGCGTCCTGGGC
GGGCCAATCGACGCCAGCCAGCTCGGAGCGGCAAACTGGGCCATTGACACCCTCGTCGAGATTGGTCCACACTCG
GCCCTCAAGGGGCCGTTGCAGCAGATTCTCAAAGACTGCGGCCTGACAGGCGTCGGCTATGCGTCAATGCTTTCT
CGAGGCGCCCATGCCATCAAGACGGCTCTGGCCTGTGCCGGCGAGCTCGTCATCTCGGGCGTGCCTGCTGCCATG
GGCCATGTCAACCTCGAGGCCGATGCCCGCCCCGTCGTCGACCTCCCGCCCTACCCGTGGAACCACTCAGCCCAG
TTTTGGGCCGAGTCGCGCCTTTCCCAAGAGTACCGCCTGCGCAAGCATCCGCGCATGCCGCTGCTGGGCAGCCCC
TGTCCTACAATGGGCGCGCGCGAACGTCTCTGGCGCGGCTTCATGAGACTCGACGAGGAGCCGTGGATCCGCCAC
CACGAGATCCAGGGCTCCATCCTCTACCCCGGCGCCGGCTTCCTCACCATGGCAATCGAGGCCGCCGCCCAACAG
GCCCGCGACCAAGACGCCTCGGTCAGCGCCTTTCGCCTGCGCGACGTCCATCTCGACGCCGCCCTCGTCGTGACC
GAGGACAGCTCCGTCGAGGCCATTCTGCAGCTGCGCCCTCACCTGCCTGCTCCGGGAAGCAGCACCGCCTCGTGG
CTCGAGTTTACCGTCAACTCGTCCATCGACAAGGGCCCGCTGCGCCAAAACTGCTCCGGCCTCATCATGCTCGAG
CACCACGCCGACCCCCACTCGGCCATGGGCCGTGAGCGCGCCTTGGACACCGACACGCTTTGCCAGCGCTTCAAG
CAGACGCGCCAGCTCTGTCGCCAGCCCGTCGACGTGCCCGACTTTTACTCGCGCCTCACTGCCCTGGGCCTCCGC
TACGGCCCCAGCTTTGCCAACGTGACAGAGATTGAGTGTGCCGACCAAGGCCGCTGCGTCGGCGCCGTGCGCATT
CCTGTCCTTGACTCCATGGGCGACAATTCCCACGTCATTCACCCCGCCACGCTCGACGCCGTCTTCCATCTCGCC
TTTGCCGCTCTCGACGGGGCCTCGCTGTCCGCGCCCATGGTGCCCACATCCATTCAGGAGCTCGTCATCGCTGCC
GACACGCCCTCGACTCCCGGAACGCTGCTCCGCGGCCTCTCGCACTCGGAGCCCTACGGCTTCCGCGAGCTCGTC
TCCGACATTGACATGCTCAACGAGCAAGGCACCAAGGCCCTGATCCAGCTCAAGGGCTTCCGATGCGCCGCGCTA
TCTACAACCCCGACGCCAGTGGCAGATGGTCGGCCCATTGCCTTTGGTGTCAGCTGGAAGCCCGCCGCAGCATTA
CTGACGAGCAAAGAGCTGCAGGCGTATATTAGTCGCAGCGCAGTGCCATGCACCGTTTCTGTCGACTCAGAAAGC
CTAGACAAGAGCCCCTCGTCCTCGGCCTTGGCAGACATGGAAAGCAAGGGAGCGCTGGCAGCCCTGGTACAGCCG
CTCGATGCATACATTGCTCTCCGTCGCCACTCAAAGCCCAATCTATCAATTGTCGAGCTTACCGCCCAGTCCGTT
CCCTACTCCCTCTTTGCCGCATTGCCTAGTCGACACAGTCTTCTTCAGACGGCGCACTATGCCATTGAGGCATCA
GCACAGGCGGCAAGGGACCAAATCAAGAGCCAGTTTGGGCCTCTGGCTTCAGAAATCGACATCACGACAGACGTC
CACGACAAGCACGACTTGGTCCTCGTCTTTGACTCGGGCTTGTCCAAGGCCCAGACAGAGGCTCTAGTGCAGAAG
GCGGCCAAGCTGCTAGGTCCAGGCGGCGCCATTATCCTGGCCGAATTAAAGGCAAATGAGGCCAACAGCTGGACC
TCGTCTCCTCTTTCAGCGTTGGACCTGACGCCTCCGCTCAACCTCGTCGACTCACAGTCTCAAGGCAGCAAGCAT
TTCCGTCTTTGCGTCTCAGACACCGCCCCCAAGCCAAATGGCGTCAAGCATCACGAGGCTCAGCAGGTAGCCTTG
ATAGAAACAGCCAATCCATCCAAGCTCGCCCAGGCCATCACGGCAGCGGTAGCTCAGCGCCTTCAAGACGCCTCC
ATTTCAGCAAGCCGTCTCTCTTGGCCGTGCGACGTATCCCAGCTCAAGGGACGCAAATGCATCGTGCTCGCCGAC
CTGGAAACGGCGCTGCTCAAAGACCCGTCGCCCGCAGACCTCGCAGCAGTACAGTCGCTCTTTTCACACGCCAAC
CAGACGCTCTGGGTCAGCGGCCCGTTGGGTCCCGACGCAGCACTCATTACCGGTCTGGCCCGCACTGTGCGCAAC
GAGGCGGTTGGCATCCAGCTGCGTACCCTCGAGCTGGCCGACGTGGCCCTCACAGATGCCGATGCTTGTGCCGAT
GCAGTGTGCCGCGTCTTTGATGCTCATACGTCGGACGACGAGTTTAGGCTTGTGTCGGCAACGTTGCAGACGAGT
CGCTTGGTTGAGGACGAGGAGCGCAACGAGGAGCTTGCTCAGATGCTCGGCCGTAAGGAAAAGACGCCGGTGGCG
AGCAAAATCCAGGAGCCGCCCCAGCCCATCAAGCTGTGCGTGGGCCAAGTCGGTATGCTGGACTCGGTCTGTTTT
GAGCCGGATGGGCTTGCTTTGGAACCGCTGGGCGAGGACGAGGTGGAAATCAACGTCAAGGCGTCAGGTGTCAAC
TTCCGAGACGTCATGGTAGCGCTGGGCCAGATTCCAGACCGCAATTTCGGCTTCGAGGGCGCCGGCATCGTGCGC
CGCGTCGGCAGCGCCAAGACGGGCTTCAGTGTCGGCCAGCGCGTCATGTTTCTTGCCCACGGGGCCCACCGCACC
GTCCACCGCGTCGCCGCCGACTTTGTCGTGTCCATGCCCGACGGGCTCAGCTTGGTGGACGGAGCAGCACTGCTG
CTCGTGCACACTACGGCCTGGTACGCGCTCGTCAGGACGGCGCGCGCCACCGCCGGCCAGTCGGTCCTGATTCAC
GCAGCGGCAGGCGGCGTGGGCCAGGCGCTGCTCATGCTGGCGCGGCACCTGCGTCTTGAAGTCTATGCTACAGTC
GGCACGGATGAGAAGCGCAAGCTGGTGCGCGAGCGCTACGGCGTGCCAGACGACCACATCTTCAACTCGCGCGAC
TTGAGCTTCGTGGCCGGCATCAAGCGCATGACGCGTGGGCGCGGCGTCGACATCATAGTCAACTCGCTGGCGGGC
GAGGCGCTGCGCCAGACGTGGTACTGTCTGGCGGCCTTTGGCACCTTTGTCGAGGTGGGCATGAAGGACATTCTC
GATAATGCGCGACTCGACATGCGGCCGTTTTTGCGCGATGCCACCTTTGCCTTTTTCAACCTCAACCACGTGCAA
AAAGAGCGGCCGGACCTGATGCGAGAGGCGCTGCGCGAGACAATGGCTCTGGTCCGCGCCGGCGTGCTCGAGCCG
GCCACGCCAACCACGTCATTCCCGGCCTCACAAGCCGAGACGGCCCTGCGCCGCATCCAGACGGGCCAGCACATG
GGCAAGCTGGTGCTCACATTCGACACGGGAGACATGGTGCCCGTGCTGAGGCCTAGTGTTGGGCTCAGCGCTTCT
GGGTCCTATCTCCTTGTCGGAGGTCTCGGCGGGCTGGGTCGCAGTCTCGCCAGGCTCTTCATCTCTCTCGGCGCC
CGCAATCTCTGCTTCCTCTCCCGCTCCGGCGCAGAAAGCAGCGGGACCAAAGCCTTTATCCACGAGCTCGAGGCC
CAGGCCGGCGTCAAGGTGCTGGTCTGCAAGGCCGACGTATCTCATGGCGAGCACGTGGCCCAAGCCGTGCAGCGC
TGCACCGCCACCCTGGGCCCCATCCAAGGCGTCGTCCAGTGCGCCATGGTGTTGCGCGACGGCCTCTTTGAGCGC
ATGACGCACTCACAGTGGCTCGAGAGCACCCGGCCCAAGGTACAGGGAACGTGCAACTTGCACCACCATGTCCCG
TCGTCGGCCTGGCTCATCACCCTCAGCTCCTTTTCCGGCATCTTTGGCAATCGCGGGCAGAGCAACTATGCTGCG
GCGGGCGCGTACCAAGATGGCCTGGCACAGCTGTGTCACGCCCAGGGCCGACGCGCAGTCACTCTCGACCTGGGC
ATCATGCGCGACGTGGGCGTCTTGGCGGAAAAGGGCATCACCGACCAGCTCCGCGAGTGGGAAGAGCCCTTTGGA
ATCCGCGAGTCGGAATTGCACGCCCTCGTCAAGTCGGCCATTATCGCCACCACGCAGCCGTCGGGCCGCTCGCCA
GCCCAAATCCCCACGGGTCTCGCCACGGCCCGCTCCGCAAAGGCAGCAGCCATCTCGCCGCCCTTTTACTTTGAC
GACGCCCGCTTCTCCATGCTGGCTCAGACGCGTCTCGACTCCGCCTCGAGCGCCACCGCCTCGTCTAGCTCGCCC
AGCGACGGCGACAAGCCCTCGGTCGAATCGCAGCTGGCCCAGGTGCATTCCGTCGACCAAGCTGCGGCCCTGGTG
CAAACGGTGCTTCTCGAGCGCGTGGCAAAGACGCTTCAAAGCGCCTCTTCGGAAATTGATCCCTCGCGCCCGCTG
CATTCGTACGGCGTGGATTCCTTGGTGGCGGTGGAAATGGTCAAGTGGATGTTTAAAGCACTGCATGCCAAGGTG
ACGGTTTTTGATGTCTTGTCCAATGTGCCCATTACGGCGCTTTGCGAAAAGGTGGCTTCCGTGTCTACTCTGGTC
AAGATTGATTAG
Transcript >OphauG2|1124
ATGGATCCTCAGCACCGCATGCTGCTCGAAGTCACCCACCAAGCCCTTGACAGCGCCGGCCTCGCCGCCCACAGC
CTCGCCGGCTCGCGTACTGGCGTCTACGCTGCACATTTCACCAGTGATTACCGCGAGGCCATTTTCCGGGATGCA
GAGGCAGCGCCACTGTATACCAATACAGGAACAAACGCCACGTCGGCGTCGAATCGCGTCTCGCACTTGTTCGAC
CTGCGCGGCCCCAGCTTTACCGTCGACACGGCCTGTTCGTCGAGCCTCGTGGCGTGCCATCTCGCGTGCCAGAGC
TTGTTGAGCCGAGAGACGGATACGGCCCTGGTCGGCGGCACCAGCTTGCTGCTCAACCCCGACATGTTTCTCTAC
CTCTCCAACCAAAAGTTCCTCTCGCCAGACGGCCAGTGCAAGACGTTTGACGCTGCAGGCGACGGCTACGGGCGC
GGCGAAGGAGTGGGCGTGCTTCTTCTAAAGCGAGTCAGCGATGCCATTCGCCATGGCGATCCCATCCGAGCCGTC
ATCCGCGGCACCGGGTGCAACCAAGACGGCCATACAAAGGGCTTCACCATTCCCAGCGTCGATGCCCAGGCCGCG
CTGATCCGGGAAACCTACTCCAAGGCCGGCCTCGACCTCGCTCAAACGCGATATGTCGAGGCTCACGGCACCGGC
ACCCAGGCCGGCGACACGCGCGAAATGGAAGGCCTGTCACGCACCTTTAGCCCCCATCGCAGCTCAGCCGACAAA
CTGCTCGTCGGGTCGGTCAAGACAAACATTGGCCATCTCGAGGCTTGTGCGGGCCTGGCCTCGCTCATCAAAAGC
ATCTATATTCTGGAGTCGGGCATCATTGCCCCAACCGCCAGCGTCAGAGTGCCAAATCCCAAGATTGAGTGGGAC
CAATGGCATCTCGCCGTGCCCGCCGTGCCCACGCCCTGGCCCACGCCCGGACTGCGACGCATCAGCACCCAGGGC
TTTGGCTACGGCGGCACCAACGCTCATGTCATCCTCGACGACGCAGCACACTATCTGCAGGCCAAGGGGCTCAGC
GGCATCCACTATACCCGCACCGCCGAGCCGAGCACGCGCCGCGCGCCAGCCACCGACCAGCCGCGCCTCTTTCTG
CTGCGTGCACATGATGGCGACGGCCTCAAGCGTGTCCGCGCCTCGCTCGCCCAGCATCTCGTCCAGCATCTCGAC
CGGCCCAACCCTTGGCCAGACTCGGCCACATATCTGCACGACTTGGCCCATACCCTCTCCAGCCGCCGCTCCCAG
CTCCAGTGGCAGACCTTTGTCACGGCCGCCTCGGAGGCTCAGTTGGTCGAGGCCCTGGGCCAAGACAGCTGGCCC
AACCCCGAGCTGCGCCGCGCCGCCACTGCGCCCCGTCTTGCCTTCATCTTCACCGGCCAGGGCGCTCAGTGGGCG
CGCATGGGCGTCGACCTCATGGCCTACCCCGTCTACCGCCAGAGCGTGCTCGACTCGGACCACTTCCTCCGCCAG
ACGCTCGGGTGCTGCTGGTCGGCGGCCGACGAGCTGGCCAAGCCACAGGCGTCGTCCAACCTGTCCCAGGCAGCA
TACAGCCAGACGCTCTGCTCCGTGCTTCAGATTGCCCTGGTCGACTTGCTCGAGCACTGGAATATCACGCCCACC
CGCGTCGCAGGCCACTCGAGCGGTGAGATTGCCGCCGCCTACTGTCTCGGGGCGCTCAGCAAGCACGACGCCCTG
CGCGTCGCCTACCATCGCGGCACCCTGTCCAGCGAGATGCAGCAGACTCACAAGCATCGCCAGGGCGCCATGATG
GCCGTGGGCGCCTCGGCTGGCCAGGTCCAAGGCTATCTGCCACGTCTGACCCGCGGCCGTGTCGTCGTGGCCTGC
ATCAACTCGCCCTCGAGCGTCACAGCCTCGGGCGACGCCGCCGCCATTGACGAGCTGCTGGACCTGGCGCAGAAA
GACGGCCTCTTTGCGCGCAAGCTTCAGGTCGACGTGGCCTACCACTCGCACCACATGGAGTCTGTTGCCACGGCC
TATGCCCAGCTCCTCGCCAACATGGAGACGCAGCCCGCCCGGCCAGGCCGCTCCATGCACTCGAGCGTCCTGGGC
GGGCCAATCGACGCCAGCCAGCTCGGAGCGGCAAACTGGGCCATTGACACCCTCGTCGAGATTGGTCCACACTCG
GCCCTCAAGGGGCCGTTGCAGCAGATTCTCAAAGACTGCGGCCTGACAGGCGTCGGCTATGCGTCAATGCTTTCT
CGAGGCGCCCATGCCATCAAGACGGCTCTGGCCTGTGCCGGCGAGCTCGTCATCTCGGGCGTGCCTGCTGCCATG
GGCCATGTCAACCTCGAGGCCGATGCCCGCCCCGTCGTCGACCTCCCGCCCTACCCGTGGAACCACTCAGCCCAG
TTTTGGGCCGAGTCGCGCCTTTCCCAAGAGTACCGCCTGCGCAAGCATCCGCGCATGCCGCTGCTGGGCAGCCCC
TGTCCTACAATGGGCGCGCGCGAACGTCTCTGGCGCGGCTTCATGAGACTCGACGAGGAGCCGTGGATCCGCCAC
CACGAGATCCAGGGCTCCATCCTCTACCCCGGCGCCGGCTTCCTCACCATGGCAATCGAGGCCGCCGCCCAACAG
GCCCGCGACCAAGACGCCTCGGTCAGCGCCTTTCGCCTGCGCGACGTCCATCTCGACGCCGCCCTCGTCGTGACC
GAGGACAGCTCCGTCGAGGCCATTCTGCAGCTGCGCCCTCACCTGCCTGCTCCGGGAAGCAGCACCGCCTCGTGG
CTCGAGTTTACCGTCAACTCGTCCATCGACAAGGGCCCGCTGCGCCAAAACTGCTCCGGCCTCATCATGCTCGAG
CACCACGCCGACCCCCACTCGGCCATGGGCCGTGAGCGCGCCTTGGACACCGACACGCTTTGCCAGCGCTTCAAG
CAGACGCGCCAGCTCTGTCGCCAGCCCGTCGACGTGCCCGACTTTTACTCGCGCCTCACTGCCCTGGGCCTCCGC
TACGGCCCCAGCTTTGCCAACGTGACAGAGATTGAGTGTGCCGACCAAGGCCGCTGCGTCGGCGCCGTGCGCATT
CCTGTCCTTGACTCCATGGGCGACAATTCCCACGTCATTCACCCCGCCACGCTCGACGCCGTCTTCCATCTCGCC
TTTGCCGCTCTCGACGGGGCCTCGCTGTCCGCGCCCATGGTGCCCACATCCATTCAGGAGCTCGTCATCGCTGCC
GACACGCCCTCGACTCCCGGAACGCTGCTCCGCGGCCTCTCGCACTCGGAGCCCTACGGCTTCCGCGAGCTCGTC
TCCGACATTGACATGCTCAACGAGCAAGGCACCAAGGCCCTGATCCAGCTCAAGGGCTTCCGATGCGCCGCGCTA
TCTACAACCCCGACGCCAGTGGCAGATGGTCGGCCCATTGCCTTTGGTGTCAGCTGGAAGCCCGCCGCAGCATTA
CTGACGAGCAAAGAGCTGCAGGCGTATATTAGTCGCAGCGCAGTGCCATGCACCGTTTCTGTCGACTCAGAAAGC
CTAGACAAGAGCCCCTCGTCCTCGGCCTTGGCAGACATGGAAAGCAAGGGAGCGCTGGCAGCCCTGGTACAGCCG
CTCGATGCATACATTGCTCTCCGTCGCCACTCAAAGCCCAATCTATCAATTGTCGAGCTTACCGCCCAGTCCGTT
CCCTACTCCCTCTTTGCCGCATTGCCTAGTCGACACAGTCTTCTTCAGACGGCGCACTATGCCATTGAGGCATCA
GCACAGGCGGCAAGGGACCAAATCAAGAGCCAGTTTGGGCCTCTGGCTTCAGAAATCGACATCACGACAGACGTC
CACGACAAGCACGACTTGGTCCTCGTCTTTGACTCGGGCTTGTCCAAGGCCCAGACAGAGGCTCTAGTGCAGAAG
GCGGCCAAGCTGCTAGGTCCAGGCGGCGCCATTATCCTGGCCGAATTAAAGGCAAATGAGGCCAACAGCTGGACC
TCGTCTCCTCTTTCAGCGTTGGACCTGACGCCTCCGCTCAACCTCGTCGACTCACAGTCTCAAGGCAGCAAGCAT
TTCCGTCTTTGCGTCTCAGACACCGCCCCCAAGCCAAATGGCGTCAAGCATCACGAGGCTCAGCAGGTAGCCTTG
ATAGAAACAGCCAATCCATCCAAGCTCGCCCAGGCCATCACGGCAGCGGTAGCTCAGCGCCTTCAAGACGCCTCC
ATTTCAGCAAGCCGTCTCTCTTGGCCGTGCGACGTATCCCAGCTCAAGGGACGCAAATGCATCGTGCTCGCCGAC
CTGGAAACGGCGCTGCTCAAAGACCCGTCGCCCGCAGACCTCGCAGCAGTACAGTCGCTCTTTTCACACGCCAAC
CAGACGCTCTGGGTCAGCGGCCCGTTGGGTCCCGACGCAGCACTCATTACCGGTCTGGCCCGCACTGTGCGCAAC
GAGGCGGTTGGCATCCAGCTGCGTACCCTCGAGCTGGCCGACGTGGCCCTCACAGATGCCGATGCTTGTGCCGAT
GCAGTGTGCCGCGTCTTTGATGCTCATACGTCGGACGACGAGTTTAGGCTTGTGTCGGCAACGTTGCAGACGAGT
CGCTTGGTTGAGGACGAGGAGCGCAACGAGGAGCTTGCTCAGATGCTCGGCCGTAAGGAAAAGACGCCGGTGGCG
AGCAAAATCCAGGAGCCGCCCCAGCCCATCAAGCTGTGCGTGGGCCAAGTCGGTATGCTGGACTCGGTCTGTTTT
GAGCCGGATGGGCTTGCTTTGGAACCGCTGGGCGAGGACGAGGTGGAAATCAACGTCAAGGCGTCAGGTGTCAAC
TTCCGAGACGTCATGGTAGCGCTGGGCCAGATTCCAGACCGCAATTTCGGCTTCGAGGGCGCCGGCATCGTGCGC
CGCGTCGGCAGCGCCAAGACGGGCTTCAGTGTCGGCCAGCGCGTCATGTTTCTTGCCCACGGGGCCCACCGCACC
GTCCACCGCGTCGCCGCCGACTTTGTCGTGTCCATGCCCGACGGGCTCAGCTTGGTGGACGGAGCAGCACTGCTG
CTCGTGCACACTACGGCCTGGTACGCGCTCGTCAGGACGGCGCGCGCCACCGCCGGCCAGTCGGTCCTGATTCAC
GCAGCGGCAGGCGGCGTGGGCCAGGCGCTGCTCATGCTGGCGCGGCACCTGCGTCTTGAAGTCTATGCTACAGTC
GGCACGGATGAGAAGCGCAAGCTGGTGCGCGAGCGCTACGGCGTGCCAGACGACCACATCTTCAACTCGCGCGAC
TTGAGCTTCGTGGCCGGCATCAAGCGCATGACGCGTGGGCGCGGCGTCGACATCATAGTCAACTCGCTGGCGGGC
GAGGCGCTGCGCCAGACGTGGTACTGTCTGGCGGCCTTTGGCACCTTTGTCGAGGTGGGCATGAAGGACATTCTC
GATAATGCGCGACTCGACATGCGGCCGTTTTTGCGCGATGCCACCTTTGCCTTTTTCAACCTCAACCACGTGCAA
AAAGAGCGGCCGGACCTGATGCGAGAGGCGCTGCGCGAGACAATGGCTCTGGTCCGCGCCGGCGTGCTCGAGCCG
GCCACGCCAACCACGTCATTCCCGGCCTCACAAGCCGAGACGGCCCTGCGCCGCATCCAGACGGGCCAGCACATG
GGCAAGCTGGTGCTCACATTCGACACGGGAGACATGGTGCCCGTGCTGAGGCCTAGTGTTGGGCTCAGCGCTTCT
GGGTCCTATCTCCTTGTCGGAGGTCTCGGCGGGCTGGGTCGCAGTCTCGCCAGGCTCTTCATCTCTCTCGGCGCC
CGCAATCTCTGCTTCCTCTCCCGCTCCGGCGCAGAAAGCAGCGGGACCAAAGCCTTTATCCACGAGCTCGAGGCC
CAGGCCGGCGTCAAGGTGCTGGTCTGCAAGGCCGACGTATCTCATGGCGAGCACGTGGCCCAAGCCGTGCAGCGC
TGCACCGCCACCCTGGGCCCCATCCAAGGCGTCGTCCAGTGCGCCATGGTGTTGCGCGACGGCCTCTTTGAGCGC
ATGACGCACTCACAGTGGCTCGAGAGCACCCGGCCCAAGGTACAGGGAACGTGCAACTTGCACCACCATGTCCCG
TCGTCGGCCTGGCTCATCACCCTCAGCTCCTTTTCCGGCATCTTTGGCAATCGCGGGCAGAGCAACTATGCTGCG
GCGGGCGCGTACCAAGATGGCCTGGCACAGCTGTGTCACGCCCAGGGCCGACGCGCAGTCACTCTCGACCTGGGC
ATCATGCGCGACGTGGGCGTCTTGGCGGAAAAGGGCATCACCGACCAGCTCCGCGAGTGGGAAGAGCCCTTTGGA
ATCCGCGAGTCGGAATTGCACGCCCTCGTCAAGTCGGCCATTATCGCCACCACGCAGCCGTCGGGCCGCTCGCCA
GCCCAAATCCCCACGGGTCTCGCCACGGCCCGCTCCGCAAAGGCAGCAGCCATCTCGCCGCCCTTTTACTTTGAC
GACGCCCGCTTCTCCATGCTGGCTCAGACGCGTCTCGACTCCGCCTCGAGCGCCACCGCCTCGTCTAGCTCGCCC
AGCGACGGCGACAAGCCCTCGGTCGAATCGCAGCTGGCCCAGGTGCATTCCGTCGACCAAGCTGCGGCCCTGGTG
CAAACGGTGCTTCTCGAGCGCGTGGCAAAGACGCTTCAAAGCGCCTCTTCGGAAATTGATCCCTCGCGCCCGCTG
CATTCGTACGGCGTGGATTCCTTGGTGGCGGTGGAAATGGTCAAGTGGATGTTTAAAGCACTGCATGCCAAGGTG
ACGGTTTTTGATGTCTTGTCCAATGTGCCCATTACGGCGCTTTGCGAAAAGGTGGCTTCCGTGTCTACTCTGGTC
AAGATTGATTAG
Gene >OphauG2|1124
ATGGATCCTCAGCACCGCATGCTGCTCGAAGTCACCCACCAAGCCCTTGACAGCGCCGGCCTCGCCGCCCACAGC
CTCGCCGGCTCGCGTACTGGCGTCTACGCTGCACATTTCACCAGTGATTACCGCGAGGCCATTTTCCGGGATGCA
GAGGCAGCGCCACTGTATACCAATACAGGAACAAACGCCACGTCGGCGTCGAATCGCGTCTCGCACTTGTTCGAC
CTGCGCGGCCCCAGCTTTACCGTCGACACGGCCTGTTCGTCGAGCCTCGTGGCGTGCCATCTCGCGTGCCAGAGC
TTGTTGAGCCGAGAGACGGATACGGCCCTGGTCGGCGGCACCAGCTTGCTGCTCAACCCCGACATGTTTCTCTAC
CTCTCCAACCAAAAGTTCCTCTCGCCAGACGGCCAGTGCAAGACGTTTGACGCTGCAGGCGACGGCTACGGGCGC
GGCGAAGGAGTGGGCGTGCTTCTTCTAAAGCGAGTCAGCGATGCCATTCGCCATGGCGATCCCATCCGAGCCGTC
ATCCGCGGCACCGGGTGCAACCAAGACGGCCATACAAAGGGCTTCACCATTCCCAGCGTCGATGCCCAGGCCGCG
CTGATCCGGGAAACCTACTCCAAGGCCGGCCTCGACCTCGCTCAAACGCGATATGTCGAGGCTCACGGCACCGGC
ACCCAGGCCGGCGACACGCGCGAAATGGAAGGCCTGTCACGCACCTTTAGCCCCCATCGCAGCTCAGCCGACAAA
CTGCTCGTCGGGTCGGTCAAGACAAACATTGGCCATCTCGAGGCTTGTGCGGGCCTGGCCTCGCTCATCAAAAGC
ATCTATATTCTGGAGTCGGGCATCATTGCCCCAACCGCCAGCGTCAGAGTGCCAAATCCCAAGATTGAGTGGGAC
CAATGGCATCTCGCCGTGCCCGCCGTGCCCACGCCCTGGCCCACGCCCGGACTGCGACGCATCAGCACCCAGGGC
TTTGGCTACGGCGGCACCAACGCTCATGTCATCCTCGACGACGCAGCACACTATCTGCAGGCCAAGGGGCTCAGC
GGCATCCACTATACCCGCACCGCCGAGCCGAGCACGCGCCGCGCGCCAGCCACCGACCAGCCGCGCCTCTTTCTG
CTGCGTGCACATGATGGCGACGGCCTCAAGCGTGTCCGCGCCTCGCTCGCCCAGCATCTCGTCCAGCATCTCGAC
CGGCCCAACCCTTGGCCAGACTCGGCCACATATCTGCACGACTTGGCCCATACCCTCTCCAGCCGCCGCTCCCAG
CTCCAGTGGCAGACCTTTGTCACGGCCGCCTCGGAGGCTCAGTTGGTCGAGGCCCTGGGCCAAGACAGCTGGCCC
AACCCCGAGCTGCGCCGCGCCGCCACTGCGCCCCGTCTTGCCTTCATCTTCACCGGCCAGGGCGCTCAGTGGGCG
CGCATGGGCGTCGACCTCATGGCCTACCCCGTCTACCGCCAGAGCGTGCTCGACTCGGACCACTTCCTCCGCCAG
ACGCTCGGGTGCTGCTGGTCGGCGGCCGACGAGCTGGCCAAGCCACAGGCGTCGTCCAACCTGTCCCAGGCAGCA
TACAGCCAGACGCTCTGCTCCGTGCTTCAGATTGCCCTGGTCGACTTGCTCGAGCACTGGAATATCACGCCCACC
CGCGTCGCAGGCCACTCGAGCGGTGAGATTGCCGCCGCCTACTGTCTCGGGGCGCTCAGCAAGCACGACGCCCTG
CGCGTCGCCTACCATCGCGGCACCCTGTCCAGCGAGATGCAGCAGACTCACAAGCATCGCCAGGGCGCCATGATG
GCCGTGGGCGCCTCGGCTGGCCAGGTCCAAGGCTATCTGCCACGTCTGACCCGCGGCCGTGTCGTCGTGGCCTGC
ATCAACTCGCCCTCGAGCGTCACAGCCTCGGGCGACGCCGCCGCCATTGACGAGCTGCTGGACCTGGCGCAGAAA
GACGGCCTCTTTGCGCGCAAGCTTCAGGTCGACGTGGCCTACCACTCGCACCACATGGAGTCTGTTGCCACGGCC
TATGCCCAGCTCCTCGCCAACATGGAGACGCAGCCCGCCCGGCCAGGCCGCTCCATGCACTCGAGCGTCCTGGGC
GGGCCAATCGACGCCAGCCAGCTCGGAGCGGCAAACTGGGTGCGCAACCTCGTCTCGCCCGTCTGCTTCTCCCAA
GCCCTCTCCAGCCTCTTGTACCACGACGGCAAGCAGGCCATTGACACCCTCGTCGAGATTGGTCCACACTCGGCC
CTCAAGGGGCCGTTGCAGCAGATTCTCAAAGACTGCGGCCTGACAGGCGTCGGCTATGCGTCAATGCTTTCTCGA
GGCGCCCATGCCATCAAGACGGCTCTGGCCTGTGCCGGCGAGCTCGTCATCTCGGGCGTGCCTGCTGCCATGGGC
CATGTCAACCTCGAGGCCGATGCCCGCCCCGTCGTCGACCTCCCGCCCTACCCGTGGAACCACTCAGCCCAGTTT
TGGGCCGAGTCGCGCCTTTCCCAAGAGTACCGCCTGCGCAAGCATCCGCGCATGCCGCTGCTGGGCAGCCCCTGT
CCTACAATGGGCGCGCGCGAACGTCTCTGGCGCGGCTTCATGAGACTCGACGAGGAGCCGTGGATCCGCCACCAC
GAGATCCAGGGCTCCATCCTCTACCCCGGCGCCGGCTTCCTCACCATGGCAATCGAGGCCGCCGCCCAACAGGCC
CGCGACCAAGACGCCTCGGTCAGCGCCTTTCGCCTGCGCGACGTCCATCTCGACGCCGCCCTCGTCGTGACCGAG
GACAGCTCCGTCGAGGCCATTCTGCAGCTGCGCCCTCACCTGCCTGCTCCGGGAAGCAGCACCGCCTCGTGGCTC
GAGTTTACCGTCAACTCGTCCATCGACAAGGGCCCGCTGCGCCAAAACTGCTCCGGCCTCATCATGCTCGAGCAC
CACGCCGACCCCCACTCGGCCATGGGCCGTGAGCGCGCCTTGGACACCGACACGCTTTGCCAGCGCTTCAAGCAG
ACGCGCCAGCTCTGTCGCCAGCCCGTCGACGTGCCCGACTTTTACTCGCGCCTCACTGCCCTGGGCCTCCGCTAC
GGCCCCAGCTTTGCCAACGTGACAGAGATTGAGTGTGCCGACCAAGGCCGCTGCGTCGGCGCCGTGCGCATTCCT
GTCCTTGACTCCATGGGCGACAATTCCCACGTCATTCACCCCGCCACGCTCGACGCCGTCTTCCATCTCGCCTTT
GCCGCTCTCGACGGGGCCTCGCTGTCCGCGCCCATGGTGCCCACATCCATTCAGGAGCTCGTCATCGCTGCCGAC
ACGCCCTCGACTCCCGGAACGCTGCTCCGCGGCCTCTCGCACTCGGAGCCCTACGGCTTCCGCGAGCTCGTCTCC
GACATTGACATGCTCAACGAGCAAGGCACCAAGGCCCTGATCCAGCTCAAGGGCTTCCGATGCGCCGCGCTATCT
ACAACCCCGACGCCAGTGGCAGATGGTCGGCCCATTGCCTTTGGTGTCAGCTGGAAGCCCGCCGCAGCATTACTG
ACGAGCAAAGAGCTGCAGGCGTATATTAGTCGCAGCGCAGTGCCATGCACCGTTTCTGTCGACTCAGAAAGCCTA
GACAAGAGCCCCTCGTCCTCGGCCTTGGCAGACATGGAAAGCAAGGGAGCGCTGGCAGCCCTGGTACAGCCGCTC
GATGCAGTACGTTGTTTCATATGCGACATACCAATCCGTTGCTAACATTCATCAGTACATTGCTCTCCGTCGCCA
CTCAAAGCCCAATCTATCAATTGTCGAGCTTACCGCCCAGTCCGTTCCCTACTCCCTCTTTGCCGCATTGCCTAG
TCGACACAGTCTTCTTCAGACGGCGCACTATGCCATTGAGGCATCAGCACAGGCGGCAAGGGACCAAATCAAGAG
CCAGTTTGGGCCTCTGGCTTCAGAAATCGACATCACGACAGACGTCCACGACAAGCACGACTTGGTCCTCGTCTT
TGACTCGGGCTTGTCCAAGGCCCAGACAGAGGCTCTAGTGCAGAAGGCGGCCAAGCTGCTAGGTCCAGGCGGCGC
CATTATCCTGGCCGAATTAAAGGCAAATGAGGCCAACAGGTAAGCCTTGGCTTTCCACGACATGGTTGCAAAACG
AGTCTTGACTAATAGCAGCAGCTGGACCTCGTCTCCTCTTTCAGCGTTGGACCTGACGCCTCCGCTCAACCTCGT
CGACTCACAGTCTCAAGGCAGCAAGCATTTCCGTCTTTGCGTCTCAGACACCGCCCCCAAGCCAAATGGCGTCAA
GCATCACGAGGCTCAGCAGGTAGCCTTGATAGAAACAGCCAATCCATCCAAGCTCGCCCAGGCCATCACGGCAGC
GGTAGCTCAGCGCCTTCAAGACGCCTCCATTTCAGCAAGCCGTCTCTCTTGGCCGTGCGACGTATCCCAGCTCAA
GGGACGCAAATGCATCGTGCTCGCCGACCTGGAAACGGCGCTGCTCAAAGACCCGTCGCCCGCAGACCTCGCAGC
AGTACAGTCGCTCTTTTCACACGCCAACCAGACGCTCTGGGTCAGCGGCCCGTTGGGTCCCGACGCAGCACTCAT
TACCGGTCTGGCCCGCACTGTGCGCAACGAGGCGGTTGGCATCCAGCTGCGTACCCTCGAGCTGGCCGACGTGGC
CCTCACAGATGCCGATGCTTGTGCCGATGCAGTGTGCCGCGTCTTTGATGCTCATACGTCGGACGACGAGTTTAG
GCTTGTGTCGGCAACGTTGCAGACGAGTCGCTTGGTTGAGGACGAGGAGCGCAACGAGGAGCTTGCTCAGATGCT
CGGCCGTAAGGAAAAGACGCCGGTGGCGAGCAAAATCCAGGAGCCGCCCCAGCCCATCAAGCTGTGCGTGGGCCA
AGTCGGTATGCTGGACTCGGTCTGTTTTGAGCCGGATGGGCTTGCTTTGGAACCGCTGGGCGAGGACGAGGTGGA
AATCAACGTCAAGGCGTCAGGTGTCAAGTAAGTCTGGAGTTGGGAAAAGCTCGCCATGAATGTTTCAAGGCGCTA
ACACACTGCAGCTTCCGAGACGTCATGGTAGCGCTGGGCCAGATTCCAGACCGCAATTTCGGCTTCGAGGGCGCC
GGCATCGTGCGCCGCGTCGGCAGCGCCAAGACGGGCTTCAGTGTCGGCCAGCGCGTCATGTTTCTTGCCCACGGG
GCCCACCGCACCGTCCACCGCGTCGCCGCCGACTTTGTCGTGTCCATGCCCGACGGGCTCAGCTTGGTGGACGGA
GCAGCACTGCTGCTCGTGCACACTACGGCCTGGTACGCGCTCGTCAGGACGGCGCGCGCCACCGCCGGCCAGTCG
GTCCTGATTCACGCAGCGGCAGGCGGCGTGGGCCAGGCGCTGCTCATGCTGGCGCGGCACCTGCGTCTTGAAGTC
TATGCTACAGTCGGCACGGATGAGAAGCGCAAGCTGGTGCGCGAGCGCTACGGCGTGCCAGACGACCACATCTTC
AACTCGCGCGACTTGAGCTTCGTGGCCGGCATCAAGCGCATGACGCGTGGGCGCGGCGTCGACATCATAGTCAAC
TCGCTGGCGGGCGAGGCGCTGCGCCAGACGTGGTACTGTCTGGCGGCCTTTGGCACCTTTGTCGAGGTGGGCATG
AAGGACATTCTCGATAATGCGCGACTCGACATGCGGCCGTTTTTGCGCGATGCCACCTTTGCCTTTTTCAACCTC
AACCACGTGCAAAAAGAGCGGCCGGACCTGATGCGAGAGGCGCTGCGCGAGACAATGGCTCTGGTCCGCGCCGGC
GTGCTCGAGCCGGCCACGCCAACCACGTCATTCCCGGCCTCACAAGCCGAGACGGCCCTGCGCCGCATCCAGACG
GGCCAGCACATGGGCAAGCTGGTGCTCACATTCGACACGGGAGACATGGTGCCCGTGCTGAGGCCTAGTGTTGGG
CTCAGCGCTTCTGGGTCCTATCTCCTTGTCGGAGGTCTCGGCGGGCTGGGTCGCAGTCTCGCCAGGCTCTTCATC
TCTCTCGGCGCCCGCAATCTCTGCTTCCTCTCCCGCTCCGGCGCAGAAAGCAGCGGGACCAAAGCCTTTATCCAC
GAGCTCGAGGCCCAGGCCGGCGTCAAGGTGCTGGTCTGCAAGGCCGACGTATCTCATGGCGAGCACGTGGCCCAA
GCCGTGCAGCGCTGCACCGCCACCCTGGGCCCCATCCAAGGCGTCGTCCAGTGCGCCATGGTGTTGCGCGACGGC
CTCTTTGAGCGCATGACGCACTCACAGTGGCTCGAGAGCACCCGGCCCAAGGTACAGGGAACGTGCAACTTGCAC
CACCATGTCCCGTCGTCGGCCTGGCTCATCACCCTCAGCTCCTTTTCCGGCATCTTTGGCAATCGCGGGCAGAGC
AACTATGCTGCGGCGGGCGCGTACCAAGATGGCCTGGCACAGCTGTGTCACGCCCAGGGCCGACGCGCAGTCACT
CTCGACCTGGGCATCATGCGCGACGTGGGCGTCTTGGCGGAAAAGGGCATCACCGACCAGCTCCGCGAGTGGGAA
GAGCCCTTTGGAATCCGCGAGTCGGAATTGCACGCCCTCGTCAAGTCGGCCATTATCGCCACCACGCAGCCGTCG
GGCCGCTCGCCAGCCCAAATCCCCACGGGTCTCGCCACGGCCCGCTCCGCAAAGGCAGCAGCCATCTCGCCGCCC
TTTTACTTTGACGACGCCCGCTTCTCCATGCTGGCTCAGACGCGTCTCGACTCCGCCTCGAGCGCCACCGCCTCG
TCTAGCTCGCCCAGCGACGGCGACAAGCCCTCGGTCGAATCGCAGCTGGCCCAGGTGCATTCCGTCGACCAAGCT
GCGGCCCTGGTGCAAACGGTGCTTCTCGAGCGCGTGGCAAAGACGCTTCAAAGCGCCTCTTCGGAAATTGATCCC
TCGCGCCCGCTGCATTCGTACGGCGTGGATTCCTTGGTGGCGGTGGAAATGGTCAAGTGGATGTTTAAAGCACTG
CATGCCAAGGTGACGGTTTTTGATGTCTTGTCCAATGTGCCCATTACGGCGCTTTGCGAAAAGGTGGCTTCCGTG
TCTACTCTGGTCAAGATTGATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail