Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1123
Gene name
LocationContig_131:22051..23209
Strand-
Gene length (bp)1158
Transcript length (bp)1092
Coding sequence length (bp)1092
Protein length (aa) 364

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00975 Thioesterase Thioesterase domain 3.8E-22 110 336

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 6 351 2.0E-60
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 356 2.0E-53
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 94 350 8.0E-53
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 106 206 9.0E-13
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 110 347 4.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q12397|STCA_EMENI Putative sterigmatocystin biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=stcA PE=3 SV=2 6 351 2.0E-60
sp|Q03149|WA_EMENI Conidial yellow pigment biosynthesis polyketide synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=wA PE=1 SV=2 12 356 2.0E-53
sp|Q12053|PKSL1_ASPPA Noranthrone synthase OS=Aspergillus parasiticus GN=pksL1 PE=1 SV=1 94 350 8.0E-53
sp|P27743|ACVS_AMYLA N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Amycolatopsis lactamdurans GN=pcbAB PE=3 SV=1 106 206 9.0E-13
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 110 347 4.0E-12
sp|P45745|DHBF_BACSU Dimodular nonribosomal peptide synthase OS=Bacillus subtilis (strain 168) GN=dhbF PE=1 SV=4 29 207 5.0E-09
sp|P27742|ACVS_EMENI N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=acvA PE=1 SV=2 109 207 5.0E-09
sp|O31784|PKSR_BACSU Polyketide synthase PksR OS=Bacillus subtilis (strain 168) GN=pksR PE=1 SV=2 153 211 3.0E-08
sp|P26046|ACVS2_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 110 207 1.0E-07
sp|P19787|ACVS1_PENCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Penicillium chrysogenum GN=PCBAB PE=3 SV=1 110 207 1.0E-07
sp|O68008|BACC_BACLI Bacitracin synthase 3 OS=Bacillus licheniformis GN=bacC PE=3 SV=1 35 215 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008150 biological_process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1123
MALTAWSGALRIIADQSGLEPDEIVEADDMQFTALGINRILAGAILSQMRGPGGEALPKDFFDRVPTVGAFRRYY
EKAAPVRPAKLTRTLSPIALSIILQKSPAVAKHVLFLLPDGSGSAMAYAGLPAVHADVCIVGLNSPHLRDASKYT
GTIEQLAETWVHEIYRRQPKGPYMVGGWSAGGYYSFEVAKRLLRDGHSVDKLVLIDSPSRTVFESLPIAVVRHLA
ARNLMGNWGSQDPPEWLIPHFQATVAAVAKYHPTPMSRASQIKTYLIWSRDGVLDTQGMASSGLDARVKVSRFLL
QGKQDWGPNGWDDLLPGQACAIATTGGTHFTMVNKPHVAELSALLSDAVAGTCPQRQHLWKQD*
Coding >OphauG2|1123
ATGGCCCTCACGGCCTGGAGCGGCGCACTGCGCATCATTGCCGACCAGAGCGGCCTCGAGCCGGATGAAATCGTC
GAGGCCGACGACATGCAATTCACGGCCCTGGGCATCAACCGCATCCTCGCCGGCGCAATTCTCTCGCAGATGCGC
GGTCCCGGCGGCGAGGCGCTTCCCAAGGACTTTTTCGACCGGGTTCCCACCGTCGGGGCCTTTCGCCGCTACTAT
GAAAAAGCAGCCCCTGTTCGCCCGGCAAAACTAACGCGGACCCTCTCGCCCATTGCCCTGTCCATCATCTTGCAA
AAGAGCCCTGCAGTGGCCAAACATGTCTTGTTTCTGCTCCCAGACGGCAGCGGGTCGGCAATGGCGTATGCCGGA
CTGCCGGCCGTGCATGCCGACGTTTGCATCGTCGGGCTCAACTCGCCGCACCTGCGCGACGCCAGCAAGTACACG
GGCACCATTGAGCAGCTGGCCGAGACGTGGGTTCACGAGATTTACCGCCGCCAGCCCAAGGGGCCGTACATGGTC
GGCGGATGGTCTGCGGGCGGCTACTATTCCTTCGAGGTGGCCAAGCGACTGCTGCGCGACGGCCACTCGGTCGAC
AAGCTGGTGCTCATCGACTCGCCCAGCCGCACCGTCTTTGAGTCGCTGCCCATTGCCGTGGTGCGCCATCTGGCG
GCCAGAAACCTCATGGGCAACTGGGGCTCGCAGGACCCGCCCGAGTGGCTGATTCCGCACTTCCAGGCCACTGTT
GCGGCCGTGGCCAAATACCATCCCACTCCCATGTCGCGCGCCTCCCAGATCAAGACGTACCTCATCTGGAGCCGC
GACGGCGTGCTGGACACGCAGGGCATGGCCAGCTCTGGCTTGGATGCCCGGGTCAAAGTGTCGCGCTTCCTGCTT
CAGGGCAAGCAGGACTGGGGCCCAAACGGCTGGGACGACCTGCTTCCGGGACAGGCCTGTGCCATTGCTACGACG
GGCGGGACGCATTTCACAATGGTCAACAAGCCTCATGTGGCTGAGCTGAGCGCCCTCTTGTCCGACGCCGTGGCT
GGAACTTGTCCCCAGCGACAGCACTTGTGGAAGCAGGACTGA
Transcript >OphauG2|1123
ATGGCCCTCACGGCCTGGAGCGGCGCACTGCGCATCATTGCCGACCAGAGCGGCCTCGAGCCGGATGAAATCGTC
GAGGCCGACGACATGCAATTCACGGCCCTGGGCATCAACCGCATCCTCGCCGGCGCAATTCTCTCGCAGATGCGC
GGTCCCGGCGGCGAGGCGCTTCCCAAGGACTTTTTCGACCGGGTTCCCACCGTCGGGGCCTTTCGCCGCTACTAT
GAAAAAGCAGCCCCTGTTCGCCCGGCAAAACTAACGCGGACCCTCTCGCCCATTGCCCTGTCCATCATCTTGCAA
AAGAGCCCTGCAGTGGCCAAACATGTCTTGTTTCTGCTCCCAGACGGCAGCGGGTCGGCAATGGCGTATGCCGGA
CTGCCGGCCGTGCATGCCGACGTTTGCATCGTCGGGCTCAACTCGCCGCACCTGCGCGACGCCAGCAAGTACACG
GGCACCATTGAGCAGCTGGCCGAGACGTGGGTTCACGAGATTTACCGCCGCCAGCCCAAGGGGCCGTACATGGTC
GGCGGATGGTCTGCGGGCGGCTACTATTCCTTCGAGGTGGCCAAGCGACTGCTGCGCGACGGCCACTCGGTCGAC
AAGCTGGTGCTCATCGACTCGCCCAGCCGCACCGTCTTTGAGTCGCTGCCCATTGCCGTGGTGCGCCATCTGGCG
GCCAGAAACCTCATGGGCAACTGGGGCTCGCAGGACCCGCCCGAGTGGCTGATTCCGCACTTCCAGGCCACTGTT
GCGGCCGTGGCCAAATACCATCCCACTCCCATGTCGCGCGCCTCCCAGATCAAGACGTACCTCATCTGGAGCCGC
GACGGCGTGCTGGACACGCAGGGCATGGCCAGCTCTGGCTTGGATGCCCGGGTCAAAGTGTCGCGCTTCCTGCTT
CAGGGCAAGCAGGACTGGGGCCCAAACGGCTGGGACGACCTGCTTCCGGGACAGGCCTGTGCCATTGCTACGACG
GGCGGGACGCATTTCACAATGGTCAACAAGCCTCATGTGGCTGAGCTGAGCGCCCTCTTGTCCGACGCCGTGGCT
GGAACTTGTCCCCAGCGACAGCACTTGTGGAAGCAGGACTGA
Gene >OphauG2|1123
ATGGCCCTCACGGCCTGGAGCGGCGCACTGCGCATCATTGCCGACCAGAGCGGCCTCGAGCCGGATGAAATCGTC
GAGGCCGACGACATGCAATTCACGGCCCTGGGCATCAACCGCATCCTCGCCGGCGCAATTCTCTCGCAGATGCGC
GGTCCCGGCGGCGAGGCGCTTCCCAAGGACTTTTTCGACCGGGTTCCCACCGTCGGGGCCTTTCGCCGCTACTAT
GAAAAAGCAGCCCCTGTTCGCCCGGCAAAACTAACGCGGACCCTCTCGCCCATTGCCCTGTCCATCATCTTGCAA
AAGAGCCCTGCAGTGGCCAAACATGTCTTGTTTCTGCTCCCAGACGGCAGCGGGTCGGCAATGGCGTATGCCGGA
CTGCCGGCCGTGCATGCCGACGTTTGCATCGTCGGGCTCAACTCGCCGCACCTGCGCGACGCCAGCAAGTACACG
GGCACCATTGAGCAGCTGGCCGAGACGTGGGTTCACGAGATTTACCGCCGCCAGCCCAAGGGGCCGTACATGGTC
GGCGGATGGTCTGCGGGCGGCTACTATTCCTTCGAGGTGGCCAAGCGACTGCTGCGCGACGGCCACTCGGTCGAC
AAGCTGGTGCTCATCGACTCGCCCAGCCGCACCGTCTTTGAGTCGCTGCCCATTGCCGTGGTGCGCCATCTGGCG
GCCAGAAACCTCATGGGCAACTGGGGCTCGCAGGACCCGCCCGAGTGGCTGATTCCGCACTTCCAGGCCACTGTT
GCGGCCGTGGCCAAATACCATCCCACTCCCATGTCGCGCGCCTCCCAGATCAAGACGTACCTCATCTGGAGCCGC
GACGGCGTGCTGGACACGCAGGGCATGGCCAGCTCTGGCTTGGATGCCCGGGTCAAAGTGTCGCGCTTCCTGCTT
CAGGGCAAGCAGGACTGGGGCCCAAACGGCTGGGACGACCTGCTTCCGGGACAGGCCTGTGCCATTGCTACGACG
GGCGGGACGCATTTCACAATGGTCAACAAGCCTCATGTAAGTTGTGTCGTGAAACAAGTCTAGAGAAACAAGTCT
AGAAACTCGGGCTAACAAGACCATCAGGTGGCTGAGCTGAGCGCCCTCTTGTCCGACGCCGTGGCTGGAACTTGT
CCCCAGCGACAGCACTTGTGGAAGCAGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail