Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1120
Gene name
LocationContig_131:16913..17534
Strand+
Gene length (bp)621
Transcript length (bp)621
Coding sequence length (bp)621
Protein length (aa) 207

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00881 Nitroreductase Nitroreductase family 3.3E-15 16 183

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96VH4|HBN1_YEAST Putative nitroreductase HBN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HBN1 PE=1 SV=1 11 204 6.0E-36
sp|P37261|FRM2_YEAST Fatty acid repression mutant protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FRM2 PE=1 SV=2 8 204 9.0E-33

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1120
MSGAKISTDAFFQAVKTRRTIYNLNKTLPISASRIQHLLGETMLHTPSSFNSQSTRALLLFGDEHDKLWTITNRT
LRAMLPDDKIAGTEERILGFQRAAGTILFFTDEAAVSALQAKMPMYADRFPPWAEQSNAMHQQTMWTALELEGLG
ANLQHYNPLIDAEVAKTWGLPESWKLNAQLVFGGKGGEPAEKTFEPLESRIKVFGA*
Coding >OphauG2|1120
ATGTCTGGTGCCAAAATCTCGACCGACGCCTTTTTCCAGGCAGTCAAGACTCGCCGCACCATTTACAACCTCAAC
AAAACCCTGCCCATCTCCGCCTCGCGCATCCAACATCTCCTTGGAGAAACCATGCTTCACACCCCTTCATCCTTC
AACTCGCAGTCTACACGCGCCCTGCTCCTCTTTGGCGACGAGCACGACAAGCTCTGGACAATAACGAACCGCACT
CTACGTGCCATGCTCCCCGATGATAAAATTGCCGGGACAGAGGAGCGCATCTTGGGATTCCAGCGCGCTGCGGGA
ACCATCCTCTTCTTCACCGACGAGGCGGCCGTGTCGGCGCTGCAGGCCAAAATGCCAATGTACGCCGACCGGTTC
CCTCCTTGGGCTGAGCAGAGCAACGCGATGCATCAGCAGACGATGTGGACGGCGCTCGAGCTAGAAGGACTGGGA
GCCAATCTCCAGCATTACAACCCCTTGATTGATGCCGAGGTGGCAAAGACGTGGGGGCTGCCAGAGAGTTGGAAG
TTGAATGCCCAGTTGGTGTTTGGAGGGAAAGGAGGGGAGCCAGCGGAGAAGACGTTTGAGCCGCTGGAGAGTCGG
ATCAAGGTTTTTGGGGCATAG
Transcript >OphauG2|1120
ATGTCTGGTGCCAAAATCTCGACCGACGCCTTTTTCCAGGCAGTCAAGACTCGCCGCACCATTTACAACCTCAAC
AAAACCCTGCCCATCTCCGCCTCGCGCATCCAACATCTCCTTGGAGAAACCATGCTTCACACCCCTTCATCCTTC
AACTCGCAGTCTACACGCGCCCTGCTCCTCTTTGGCGACGAGCACGACAAGCTCTGGACAATAACGAACCGCACT
CTACGTGCCATGCTCCCCGATGATAAAATTGCCGGGACAGAGGAGCGCATCTTGGGATTCCAGCGCGCTGCGGGA
ACCATCCTCTTCTTCACCGACGAGGCGGCCGTGTCGGCGCTGCAGGCCAAAATGCCAATGTACGCCGACCGGTTC
CCTCCTTGGGCTGAGCAGAGCAACGCGATGCATCAGCAGACGATGTGGACGGCGCTCGAGCTAGAAGGACTGGGA
GCCAATCTCCAGCATTACAACCCCTTGATTGATGCCGAGGTGGCAAAGACGTGGGGGCTGCCAGAGAGTTGGAAG
TTGAATGCCCAGTTGGTGTTTGGAGGGAAAGGAGGGGAGCCAGCGGAGAAGACGTTTGAGCCGCTGGAGAGTCGG
ATCAAGGTTTTTGGGGCATAG
Gene >OphauG2|1120
ATGTCTGGTGCCAAAATCTCGACCGACGCCTTTTTCCAGGCAGTCAAGACTCGCCGCACCATTTACAACCTCAAC
AAAACCCTGCCCATCTCCGCCTCGCGCATCCAACATCTCCTTGGAGAAACCATGCTTCACACCCCTTCATCCTTC
AACTCGCAGTCTACACGCGCCCTGCTCCTCTTTGGCGACGAGCACGACAAGCTCTGGACAATAACGAACCGCACT
CTACGTGCCATGCTCCCCGATGATAAAATTGCCGGGACAGAGGAGCGCATCTTGGGATTCCAGCGCGCTGCGGGA
ACCATCCTCTTCTTCACCGACGAGGCGGCCGTGTCGGCGCTGCAGGCCAAAATGCCAATGTACGCCGACCGGTTC
CCTCCTTGGGCTGAGCAGAGCAACGCGATGCATCAGCAGACGATGTGGACGGCGCTCGAGCTAGAAGGACTGGGA
GCCAATCTCCAGCATTACAACCCCTTGATTGATGCCGAGGTGGCAAAGACGTGGGGGCTGCCAGAGAGTTGGAAG
TTGAATGCCCAGTTGGTGTTTGGAGGGAAAGGAGGGGAGCCAGCGGAGAAGACGTTTGAGCCGCTGGAGAGTCGG
ATCAAGGTTTTTGGGGCATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail