Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1115
Gene name
LocationContig_131:1214..2450
Strand+
Gene length (bp)1236
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19189 Mtf2 Mtf2 family 1.8E-20 190 367

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005739 mitochondrion Yes
GO:0043229 intracellular organelle No
GO:0043231 intracellular membrane-bounded organelle No
GO:0043226 organelle No
GO:0043227 membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0110165 cellular anatomical entity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3689
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1115 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1600
Ophiocordyceps camponoti-floridani Ophcf2|02633
Ophiocordyceps camponoti-rufipedis Ophun1|6992
Ophiocordyceps kimflemingae Ophio5|3363
Ophiocordyceps subramaniannii Hirsu2|7150

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1115
MPPSSLSFLYHTPTIRQALRLATRSRPLAAASRNVHSDDKTGQSSYYRDNTVPFDWENSKLPPPVYGITPNRSST
LTPSEAEAFRAIFDEIANGQMPKSPRKKKTDSAQEVEQEATSKPAQAETDTGGDGFRQSLLASLPDSLRSAAEIA
LGVHTLPSDTPGQIHMVPLDKADQVDRELRTSHNKARASERQRIGNLLTDCRTDVALWEAMHKHVFTLPQRLNIC
NMSDPQKLTVLAHKPNEALGEANAPQGTEETLPVEIYGPLYPYLLRKSLALFEKAFDRPSPLAFYILPQVKALGP
ASYLLGVTKPLLIRLARMHWQQFGDADSALDVLEESNTACINVDDSFRRLLVAIRNQVRLCTGGVQSDVVQAVVK
TAQYQKVVKERVEPMHKWAVEYIGERKKKGSRHSLL*
Coding >OphauG2|1115
ATGCCGCCAAGCAGTCTTTCCTTTCTCTACCACACTCCAACAATCCGCCAGGCTCTTCGACTCGCAACTCGCTCC
CGGCCTCTTGCGGCAGCTTCACGCAATGTGCACTCGGACGATAAAACGGGACAAAGCAGTTATTATCGCGACAAT
ACCGTCCCTTTCGACTGGGAAAACTCCAAACTCCCCCCTCCGGTATACGGCATCACGCCAAACCGCTCATCAACC
CTGACCCCATCAGAAGCCGAAGCCTTCAGGGCAATCTTTGATGAAATCGCAAACGGCCAAATGCCAAAAAGCCCA
AGGAAGAAGAAGACGGACTCGGCGCAAGAGGTGGAACAAGAAGCAACATCAAAACCTGCGCAAGCTGAGACGGAC
ACGGGTGGCGACGGTTTTCGCCAGAGTTTGCTCGCTAGTCTTCCAGACTCTCTGCGCTCTGCTGCTGAGATTGCC
CTGGGCGTCCATACCCTTCCCTCGGACACACCAGGGCAAATACACATGGTGCCACTGGATAAGGCAGATCAGGTG
GATCGCGAGTTGCGCACAAGTCACAACAAGGCAAGAGCCTCGGAACGCCAGCGCATCGGAAACCTTCTGACGGAT
TGTAGAACCGATGTTGCCCTGTGGGAGGCCATGCACAAACACGTATTCACTCTCCCGCAAAGACTCAACATTTGC
AACATGTCGGATCCTCAGAAACTGACCGTCTTGGCCCACAAGCCCAACGAGGCTCTCGGCGAGGCCAACGCTCCA
CAAGGAACAGAAGAGACACTGCCCGTGGAGATATATGGACCGCTGTATCCTTACCTGCTGAGAAAAAGCCTCGCT
CTCTTTGAGAAAGCATTTGACCGTCCCTCGCCCTTGGCGTTTTACATTTTGCCCCAGGTCAAGGCTCTTGGTCCT
GCATCGTATCTGCTGGGCGTGACAAAGCCCCTTTTAATACGACTTGCCCGGATGCATTGGCAGCAGTTTGGCGAT
GCTGATTCGGCTCTAGATGTTTTGGAAGAGAGTAATACGGCATGTATCAATGTTGATGACAGCTTTCGAAGGCTT
CTCGTCGCAATACGGAATCAGGTTCGTCTCTGCACTGGTGGTGTCCAAAGTGACGTTGTGCAGGCCGTGGTCAAG
ACAGCACAGTACCAGAAAGTCGTGAAAGAAAGAGTCGAGCCCATGCATAAATGGGCGGTGGAATACATTGGAGAG
AGGAAGAAGAAGGGGTCGCGGCACTCGCTGCTTTGA
Transcript >OphauG2|1115
ATGCCGCCAAGCAGTCTTTCCTTTCTCTACCACACTCCAACAATCCGCCAGGCTCTTCGACTCGCAACTCGCTCC
CGGCCTCTTGCGGCAGCTTCACGCAATGTGCACTCGGACGATAAAACGGGACAAAGCAGTTATTATCGCGACAAT
ACCGTCCCTTTCGACTGGGAAAACTCCAAACTCCCCCCTCCGGTATACGGCATCACGCCAAACCGCTCATCAACC
CTGACCCCATCAGAAGCCGAAGCCTTCAGGGCAATCTTTGATGAAATCGCAAACGGCCAAATGCCAAAAAGCCCA
AGGAAGAAGAAGACGGACTCGGCGCAAGAGGTGGAACAAGAAGCAACATCAAAACCTGCGCAAGCTGAGACGGAC
ACGGGTGGCGACGGTTTTCGCCAGAGTTTGCTCGCTAGTCTTCCAGACTCTCTGCGCTCTGCTGCTGAGATTGCC
CTGGGCGTCCATACCCTTCCCTCGGACACACCAGGGCAAATACACATGGTGCCACTGGATAAGGCAGATCAGGTG
GATCGCGAGTTGCGCACAAGTCACAACAAGGCAAGAGCCTCGGAACGCCAGCGCATCGGAAACCTTCTGACGGAT
TGTAGAACCGATGTTGCCCTGTGGGAGGCCATGCACAAACACGTATTCACTCTCCCGCAAAGACTCAACATTTGC
AACATGTCGGATCCTCAGAAACTGACCGTCTTGGCCCACAAGCCCAACGAGGCTCTCGGCGAGGCCAACGCTCCA
CAAGGAACAGAAGAGACACTGCCCGTGGAGATATATGGACCGCTGTATCCTTACCTGCTGAGAAAAAGCCTCGCT
CTCTTTGAGAAAGCATTTGACCGTCCCTCGCCCTTGGCGTTTTACATTTTGCCCCAGGTCAAGGCTCTTGGTCCT
GCATCGTATCTGCTGGGCGTGACAAAGCCCCTTTTAATACGACTTGCCCGGATGCATTGGCAGCAGTTTGGCGAT
GCTGATTCGGCTCTAGATGTTTTGGAAGAGAGTAATACGGCATGTATCAATGTTGATGACAGCTTTCGAAGGCTT
CTCGTCGCAATACGGAATCAGGTTCGTCTCTGCACTGGTGGTGTCCAAAGTGACGTTGTGCAGGCCGTGGTCAAG
ACAGCACAGTACCAGAAAGTCGTGAAAGAAAGAGTCGAGCCCATGCATAAATGGGCGGTGGAATACATTGGAGAG
AGGAAGAAGAAGGGGTCGCGGCACTCGCTGCTTTGA
Gene >OphauG2|1115
ATGCCGCCAAGCAGTCTTTCCTTTCTCTACCACACTCCAACAATCCGCCAGGCTCTTCGACTCGCAACTCGCTCC
CGGCCTCTTGCGGCAGCTTCACGCAATGTGCACTCGGACGATAAAACGGGACAAAGCAGTTATTATCGCGACAAT
ACCGTCCCTTTCGACTGGGAAAACTCCAAACTCCCCCCTCCGGTATACGGCATCACGCCAAACCGCTCATCAACC
CTGACCCCATCAGAAGCCGAAGCCTTCAGGGCAATCTTTGATGAAATCGCAAACGGCCAAATGCCAAAAAGCCCA
AGGAAGAAGAAGACGGACTCGGCGCAAGAGGTGGAACAAGAAGCAACATCAAAACCTGCGCAAGCTGAGACGGAC
ACGGGTGGCGACGGTTTTCGCCAGAGTTTGCTCGCTAGTCTTCCAGACTCTCTGCGCTCTGCTGCTGAGATTGCC
CTGGGCGTCCATACCCTTCCCTCGGACACACCAGGGCAAATACACATGGTGCCACTGGATAAGGCAGATCAGGTG
GATCGCGAGTTGCGCACAAGTCACAACAAGGCAAGAGCCTCGGAACGCCAGCGCATCGGAAACCTTCTGACGGAT
TGTAGAACCGATGTTGCCCTGTGGGAGGCCATGCACAAACACGTATTCACTCTCCCGCAAAGACTCAACATTTGC
AACATGTCGGATCCTCAGAAACTGACCGTCTTGGCCCACAAGCCCAACGAGGCTCTCGGCGAGGCCAACGCTCCA
CAAGGAACAGAAGAGACACTGCCCGTGGAGATATATGGACCGCTGTATCCTTACCTGCTGAGAAAAAGCCTCGCT
CTCTTTGAGAAAGCATTTGACCGTCCCTCGCCCTTGGCGTTTTACATTTTGCCCCAGGTCAAGGCTCTTGGTCCT
GCATCGTATCTGCTGGGCGTGACAAAGCCCCTTTTAATACGACTTGCCCGGATGCATTGGCAGCAGTTTGGCGAT
GCTGATTCGGCTCTAGATGTTTTGGAAGAGAGTAATACGGCATGTATCAATGTTGATGACAGCTTTCGAAGGCTT
CTCGTCGCAATACGGAATCAGGTTCGTCTCTGCACTGGTGGTGTCCAAAGTGACGTTGTGCAGGCCGTGGTCAAG
ACAGCACAGTACCAGAAAGTCGTGAAAGAAAGAGTCGAGCCCATGCATAAATGGGCGGTGGAATACATTGGAGAG
AGGAAGAAGAAGGGGTCGCGGCACTCGCTGCTTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail