Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1109
Gene name
LocationContig_1307:27..2183
Strand-
Gene length (bp)2156
Transcript length (bp)1710
Coding sequence length (bp)1710
Protein length (aa) 570

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04820 Trp_halogenase Tryptophan halogenase 3.5E-13 10 92
PF04820 Trp_halogenase Tryptophan halogenase 1.6E-13 102 379
PF01494 FAD_binding_3 FAD binding domain 2.3E-14 7 363

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q0VZ69|THAL_CHOCO Tryptophan 2-halogenase OS=Chondromyces crocatus GN=cmdE PE=4 SV=1 4 378 3.0E-70
sp|P96800|Y1602_METBF Uncharacterized protein Mbar_A1602 OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=Mbar_A1602 PE=3 SV=2 7 349 3.0E-12
sp|O07561|YHJG_BACSU Uncharacterized aromatic compound monooxygenase YhjG OS=Bacillus subtilis (strain 168) GN=yhjG PE=3 SV=1 7 364 3.0E-06
sp|Q12YW2|GGR1_METBU Digeranylgeranylglycerophospholipid reductase 1 OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=Mbur_0369 PE=3 SV=1 10 363 7.0E-06

GO

GO Term Description Terminal node
GO:0071949 FAD binding Yes
GO:0004497 monooxygenase activity Yes
GO:0003674 molecular_function No
GO:0016491 oxidoreductase activity No
GO:1901363 heterocyclic compound binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0050660 flavin adenine dinucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:0000166 nucleotide binding No
GO:1901265 nucleoside phosphate binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup339
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1109 (this protein)
Ophiocordyceps australis 1348a (Ghana) OphauG2|1662
Ophiocordyceps australis map64 (Brazil) OphauB2|588
Ophiocordyceps australis map64 (Brazil) OphauB2|6448
Ophiocordyceps camponoti-floridani Ophcf2|06233
Ophiocordyceps camponoti-rufipedis Ophun1|1945
Ophiocordyceps camponoti-rufipedis Ophun1|4166
Ophiocordyceps kimflemingae Ophio5|2110
Ophiocordyceps subramaniannii Hirsu2|4346
Ophiocordyceps subramaniannii Hirsu2|7114

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1109
MATVPNKCTVLVIGGGPAGSYASSALAREGVDVVCLEAEKFPRYHIGESMLPSMRHFLKFIDCYEKWDAHGFNVK
NGGAFRLNWSRPESYTDFIAAGGSQGYAWNVIRSEADELLFKHAGECGVKTFDETKVASIEFAPREADAPENQPF
GRPVSATWTRKDGSSGVIAVDYIVDASGRNGLLSTRYLKNRAYNQGLKNIANWAYWKGAGVHGVGTFKEGAPYFE
ALKDASGWVWFIPLHNGTTSVGVVQNQEMATAKKRQMAEPSSKGFYLESLELVPGIKDLLAKAELVTEVKSASDW
SYSASNYAFPGVRIAGDAGSFIDPFFSSGVHLALSGGLSAATTIAAAIRGDCDEKFAASWHDKKTAESYTRFLVV
VSSALKQIRAQDQPVITDFDEDTFERAFDLFRPIIQGQADSDFKGKLSQAEISKTVEFCFKAFAHVSYEDKEALV
KKLKDLGLDGDAHDEKNRQALDELEKKLTPEERSILTTLKGRRMVRPEDSLNIDNFTLDSIDGFAPRLERGKLGL
AAAEKAKVKYTAHDLLSHLNGEARAAKTALENGAAAKNGSNGWA*
Coding >OphauG2|1109
ATGGCCACGGTCCCAAACAAATGCACCGTGTTGGTGATTGGGGGCGGCCCAGCTGGCTCGTATGCCTCTTCAGCT
CTCGCTCGCGAGGGCGTAGATGTCGTTTGCCTCGAAGCGGAGAAATTTCCCAGATACCACATCGGCGAGAGCATG
TTGCCGTCCATGAGACATTTCCTCAAGTTTATTGACTGCTACGAAAAATGGGACGCCCACGGCTTCAACGTCAAG
AATGGTGGTGCGTTCCGGCTTAATTGGTCCCGGCCAGAGAGTTATACCGACTTTATCGCGGCGGGGGGCTCGCAG
GGCTATGCGTGGAACGTGATTCGATCTGAAGCAGACGAGCTGCTCTTCAAACACGCGGGCGAGTGCGGAGTCAAG
ACATTTGATGAGACAAAGGTTGCGTCTATTGAATTCGCGCCTCGAGAGGCCGACGCGCCAGAGAACCAGCCCTTT
GGCCGCCCCGTGTCTGCGACTTGGACGCGCAAAGACGGCTCGTCTGGCGTCATTGCCGTCGACTACATTGTCGAT
GCTTCGGGGCGAAACGGCTTGCTCAGCACTCGCTATCTCAAGAACCGAGCCTACAACCAAGGGCTCAAGAACATT
GCCAACTGGGCCTACTGGAAGGGCGCCGGCGTCCACGGCGTTGGAACCTTTAAAGAAGGCGCTCCATACTTTGAA
GCTCTCAAGGACGCCAGCGGATGGGTGTGGTTTATCCCTCTGCACAATGGCACCACCTCTGTCGGAGTCGTGCAG
AACCAGGAAATGGCCACGGCCAAGAAGCGCCAGATGGCTGAGCCGTCATCCAAGGGCTTCTACCTCGAGTCTCTC
GAGCTCGTGCCCGGCATCAAGGACCTGCTGGCAAAGGCCGAGCTCGTCACTGAGGTCAAGTCGGCGTCGGACTGG
TCCTACAGCGCCTCCAACTATGCCTTTCCTGGCGTGCGCATTGCCGGCGACGCGGGCTCCTTTATCGACCCCTTC
TTTTCGTCGGGCGTCCACCTGGCGCTGTCTGGCGGTCTCTCGGCCGCAACAACCATTGCTGCAGCGATCCGCGGC
GACTGCGATGAAAAGTTTGCGGCGTCGTGGCATGACAAGAAGACGGCCGAGAGCTATACTCGCTTCCTGGTGGTC
GTGTCCAGTGCCTTGAAGCAAATCCGCGCTCAGGATCAGCCTGTAATTACCGATTTCGACGAGGATACGTTTGAG
CGTGCCTTTGACCTCTTTCGCCCCATCATTCAGGGCCAGGCCGACTCGGACTTCAAGGGAAAACTCAGCCAGGCC
GAAATCTCCAAAACCGTGGAATTCTGCTTCAAGGCGTTTGCCCACGTCTCCTACGAGGACAAGGAAGCTCTCGTC
AAGAAACTCAAAGACCTCGGCCTTGACGGCGACGCCCACGATGAAAAGAACCGCCAGGCTCTGGACGAGCTGGAG
AAGAAGCTGACGCCAGAGGAGCGCTCCATCCTCACCACGCTCAAGGGCCGGCGCATGGTTCGTCCCGAGGACTCG
CTCAACATTGACAACTTTACCCTGGACTCGATTGACGGCTTTGCGCCGCGTCTGGAGCGCGGGAAGCTCGGGCTG
GCGGCGGCGGAAAAGGCAAAGGTCAAGTATACCGCTCACGATTTGCTTTCACACTTGAACGGCGAGGCCAGAGCA
GCAAAGACGGCGCTGGAAAACGGCGCCGCCGCCAAGAATGGAAGCAATGGCTGGGCATGA
Transcript >OphauG2|1109
ATGGCCACGGTCCCAAACAAATGCACCGTGTTGGTGATTGGGGGCGGCCCAGCTGGCTCGTATGCCTCTTCAGCT
CTCGCTCGCGAGGGCGTAGATGTCGTTTGCCTCGAAGCGGAGAAATTTCCCAGATACCACATCGGCGAGAGCATG
TTGCCGTCCATGAGACATTTCCTCAAGTTTATTGACTGCTACGAAAAATGGGACGCCCACGGCTTCAACGTCAAG
AATGGTGGTGCGTTCCGGCTTAATTGGTCCCGGCCAGAGAGTTATACCGACTTTATCGCGGCGGGGGGCTCGCAG
GGCTATGCGTGGAACGTGATTCGATCTGAAGCAGACGAGCTGCTCTTCAAACACGCGGGCGAGTGCGGAGTCAAG
ACATTTGATGAGACAAAGGTTGCGTCTATTGAATTCGCGCCTCGAGAGGCCGACGCGCCAGAGAACCAGCCCTTT
GGCCGCCCCGTGTCTGCGACTTGGACGCGCAAAGACGGCTCGTCTGGCGTCATTGCCGTCGACTACATTGTCGAT
GCTTCGGGGCGAAACGGCTTGCTCAGCACTCGCTATCTCAAGAACCGAGCCTACAACCAAGGGCTCAAGAACATT
GCCAACTGGGCCTACTGGAAGGGCGCCGGCGTCCACGGCGTTGGAACCTTTAAAGAAGGCGCTCCATACTTTGAA
GCTCTCAAGGACGCCAGCGGATGGGTGTGGTTTATCCCTCTGCACAATGGCACCACCTCTGTCGGAGTCGTGCAG
AACCAGGAAATGGCCACGGCCAAGAAGCGCCAGATGGCTGAGCCGTCATCCAAGGGCTTCTACCTCGAGTCTCTC
GAGCTCGTGCCCGGCATCAAGGACCTGCTGGCAAAGGCCGAGCTCGTCACTGAGGTCAAGTCGGCGTCGGACTGG
TCCTACAGCGCCTCCAACTATGCCTTTCCTGGCGTGCGCATTGCCGGCGACGCGGGCTCCTTTATCGACCCCTTC
TTTTCGTCGGGCGTCCACCTGGCGCTGTCTGGCGGTCTCTCGGCCGCAACAACCATTGCTGCAGCGATCCGCGGC
GACTGCGATGAAAAGTTTGCGGCGTCGTGGCATGACAAGAAGACGGCCGAGAGCTATACTCGCTTCCTGGTGGTC
GTGTCCAGTGCCTTGAAGCAAATCCGCGCTCAGGATCAGCCTGTAATTACCGATTTCGACGAGGATACGTTTGAG
CGTGCCTTTGACCTCTTTCGCCCCATCATTCAGGGCCAGGCCGACTCGGACTTCAAGGGAAAACTCAGCCAGGCC
GAAATCTCCAAAACCGTGGAATTCTGCTTCAAGGCGTTTGCCCACGTCTCCTACGAGGACAAGGAAGCTCTCGTC
AAGAAACTCAAAGACCTCGGCCTTGACGGCGACGCCCACGATGAAAAGAACCGCCAGGCTCTGGACGAGCTGGAG
AAGAAGCTGACGCCAGAGGAGCGCTCCATCCTCACCACGCTCAAGGGCCGGCGCATGGTTCGTCCCGAGGACTCG
CTCAACATTGACAACTTTACCCTGGACTCGATTGACGGCTTTGCGCCGCGTCTGGAGCGCGGGAAGCTCGGGCTG
GCGGCGGCGGAAAAGGCAAAGGTCAAGTATACCGCTCACGATTTGCTTTCACACTTGAACGGCGAGGCCAGAGCA
GCAAAGACGGCGCTGGAAAACGGCGCCGCCGCCAAGAATGGAAGCAATGGCTGGGCATGA
Gene >OphauG2|1109
ATGGCCACGGTCCCAAACAAATGCACCGTGTTGGTGATTGGGGGCGGCCCAGCTGGCTCGTATGCCTCTTCAGCT
CTCGCTCGCGAGGGCGTAGATGTCGTTTGCCTCGAAGCGGAGAAATTTCCCAGGTGAGGATTAGGCGCATCAATG
GCATGATTCATGAAAAGTGACTGACCAACGGAAAATGCTAGATACCACATCGGCGAGAGCATGTTGCCGTCCATG
AGACATTTCCTCAAGTTTATTGACTGCTACGAAAAATGGGACGCCCACGGCTTCAACGTCAAGGTAGGCAAATCT
GACCGTTTTGGGAAGACGGGTAAGAATAGGCGAGTTAACGTTGGGCGTCACAGAATGGTGGTGCGTTCCGGCTTA
ATTGGTCCCGGCCAGAGAGTTGTAAGTCGGAAGCAAATCTCACCCAACACTTGAGCAAAATTGGCGCAATGGTGG
CACAATGGTCACACAATCGCTAGACAATGGTTACGCAATGACTCAATGACTCACTCTTTGCTTTTTCAAGATACC
GACTTTATCGCGGCGGGGGGCTCGCAGGGCTATGCGTGGAACGTGATTCGATCTGAAGCAGACGAGCTGCTCTTC
AAACACGCGGGCGAGTGCGGAGTCAAGACATTTGATGAGACAAAGGTTGCGTCTATTGAATTCGCGCCTCGAGAG
GCCGACGCGCCAGAGAACCAGCCCTTTGGCCGCCCCGTGTCTGCGACTTGGACGCGCAAAGACGGCTCGTCTGGC
GTCATTGCCGTCGACTACATTGTCGATGCTTCGGGGCGAAACGGCTTGCTCAGCACTCGCTATCTCAAGAACCGA
GCCTACAACCAAGGGCTCAAGAACATTGCCAACTGGGCCTACTGGAAGGGCGCCGGCGTCCACGGCGTTGGAACC
TTTAAAGAAGGCGCTCCATACTTTGAAGCTCTCAAGGGCACGTAGGCCCCCTTTTACGTGGAGGAATCCAATATT
TTGCTAACATGAGCGCTTCTCGCCCTGCAGACGCCAGCGGATGGGTGTGGTTTATCCCTCTGCACAATGGCACCA
CCTCTGTCGGAGTCGTGCAGAACCAGGAAATGGCCACGGCCAAGAAGCGCCAGATGGCTGAGCCGTCATCCAAGG
GCTTCTACCTCGAGTCTCTCGAGCTCGTGCCCGGCATCAAGGACCTGCTGGCAAAGGCCGAGCTCGTCACTGAGG
TCAAGTCGGCGTCGGACTGGTCCTACAGCGCCTCCAACTATGCCTTTCCTGGCGTGCGCATTGCCGGCGACGCGG
GCTCCTTTATCGACCCCTTCTTTTCGTCGGGCGTCCACCTGGCGCTGTCTGGCGGTCTCTCGGCCGCAACAACCA
TTGCTGCAGCGATCCGCGGCGACTGCGATGAAAAGTTTGCGGCGTCGTGGCATGACAAGAAGACGGCCGAGAGCT
ATACTCGCTTCCTGGTGGTCGTGTCCAGTGCCTTGAAGCAAATCCGCGCTCAGGATCAGCCTGTAATTACCGATT
TCGACGAGGATACGTTTGAGCGTGCCTTTGACCTCTTTCGCCCCAGTAAGCCAATCAACCCCCTTTTTTTCAAAA
GTTAAGAAAAAACAGACTCTTACCCTTTTTATTACAGTCATTCAGGGCCAGGCCGACTCGGACTTCAAGGGAAAA
CTCAGCCAGGCCGAAATCTCCAAAACCGTGGAATTCTGCTTCAAGGCGTTTGCCCACGTCTCCTACGAGGACAAG
GAAGCTCTCGTCAAGAAACTCAAAGACCTCGGCCTTGACGGCGACGCCCACGATGAAAAGAACCGCCAGGCTCTG
GACGAGCTGGAGAAGAAGCTGACGCCAGAGGAGCGCTCCATCCTCACCACGCTCAAGGGCCGGCGCATGGTTCGT
CCCGAGGACTCGCTCAACATTGACAACTTTACCCTGGACTCGATTGACGGCTTTGCGCCGCGTCTGGAGCGCGGG
AAGCTCGGGCTGGCGGCGGCGGAAAAGGCAAAGGTCAAGTATACCGCTCACGATTTGCTTTCACACTTGAACGGC
GAGGCCAGAGCAGCAAAGACGGCGCTGGAAAACGGCGCCGCCGCCAAGAATGGAAGCAATGGCGTCAATGGCCAT
GGTGCTTCCAATGGAGTCAATGGACATGATGCTGCCAACGGAGTCAGTGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail