Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1103
Gene name
LocationContig_1302:1497..4260
Strand+
Gene length (bp)2763
Transcript length (bp)2679
Coding sequence length (bp)2679
Protein length (aa) 893

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04130 GCP_C_terminal Gamma tubulin complex component C-terminal 2.2E-58 491 871
PF17681 GCP_N_terminal Gamma tubulin complex component N-terminal 1.6E-55 145 486

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 77 871 0.0E+00
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 131 859 9.0E-109
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 131 859 3.0E-108
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 131 859 2.0E-104
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 110 775 3.0E-80
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y705|ALP4_SCHPO Spindle pole body component alp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp4 PE=1 SV=1 77 871 0.0E+00
sp|Q5R5J6|GCP2_PONAB Gamma-tubulin complex component 2 OS=Pongo abelii GN=TUBGCP2 PE=2 SV=1 131 859 9.0E-109
sp|Q9BSJ2|GCP2_HUMAN Gamma-tubulin complex component 2 OS=Homo sapiens GN=TUBGCP2 PE=1 SV=2 131 859 3.0E-108
sp|Q921G8|GCP2_MOUSE Gamma-tubulin complex component 2 OS=Mus musculus GN=Tubgcp2 PE=1 SV=2 131 859 2.0E-104
sp|Q9C5H9|GACP2_ARATH Gamma-tubulin complex component 2 OS=Arabidopsis thaliana GN=GCP2 PE=1 SV=1 110 775 3.0E-80
sp|Q95ZG3|SPC97_DICDI Spindle pole body component 97 OS=Dictyostelium discoideum GN=spc97 PE=2 SV=2 140 783 3.0E-77
sp|Q9XYP7|GCP2_DROME Gamma-tubulin complex component 2 homolog OS=Drosophila melanogaster GN=Grip84 PE=1 SV=2 82 871 2.0E-75
sp|P38863|SPC97_YEAST Spindle pole body component SPC97 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPC97 PE=1 SV=1 109 705 5.0E-30
sp|O73787|GCP3_XENLA Gamma-tubulin complex component 3 homolog OS=Xenopus laevis GN=tubgcp3 PE=1 SV=1 130 749 8.0E-25
sp|P58854|GCP3_MOUSE Gamma-tubulin complex component 3 OS=Mus musculus GN=Tubgcp3 PE=1 SV=2 135 755 2.0E-23
sp|Q96CW5|GCP3_HUMAN Gamma-tubulin complex component 3 OS=Homo sapiens GN=TUBGCP3 PE=1 SV=2 135 749 2.0E-23
sp|Q9XYP8|GCP3_DROME Gamma-tubulin complex component 3 homolog OS=Drosophila melanogaster GN=l(1)dd4 PE=1 SV=2 348 751 3.0E-22
sp|Q9USQ2|ALP6_SCHPO Spindle pole body component alp6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alp6 PE=1 SV=2 348 753 3.0E-19
sp|Q9M350|GACP4_ARATH Gamma-tubulin complex component 4 OS=Arabidopsis thaliana GN=GCP4 PE=2 SV=2 331 769 3.0E-16
sp|Q9FG37|GACP3_ARATH Gamma-tubulin complex component 3 OS=Arabidopsis thaliana GN=GCP3 PE=1 SV=1 328 749 3.0E-14
sp|Q9SC88|GCP4_MEDTR Gamma-tubulin complex component 4 homolog OS=Medicago truncatula GN=85P PE=2 SV=1 331 769 2.0E-13
sp|Q9VKU7|GCP4_DROME Gamma-tubulin complex component 4 homolog OS=Drosophila melanogaster GN=Grip75 PE=1 SV=2 331 751 1.0E-10
sp|Q9D4F8|GCP4_MOUSE Gamma-tubulin complex component 4 OS=Mus musculus GN=Tubgcp4 PE=1 SV=2 593 770 1.0E-08
sp|Q9UGJ1|GCP4_HUMAN Gamma-tubulin complex component 4 OS=Homo sapiens GN=TUBGCP4 PE=1 SV=1 608 770 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0043015 gamma-tubulin binding Yes
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0008092 cytoskeletal protein binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1995
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1103 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|3544
Ophiocordyceps camponoti-floridani Ophcf2|04172
Ophiocordyceps camponoti-rufipedis Ophun1|1225
Ophiocordyceps kimflemingae Ophio5|2139
Ophiocordyceps subramaniannii Hirsu2|2232

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1103
MEAGSWTGANRGQGGVSPRGDSQHGSTWGHRPRGLSTSERRYSERRVTERTLEARIERVRRTSPGRRQARRSGGR
VEKKSPSPSPSRDTVPAAAWQPETMLLAHTSAPLARRISLPPQASTVPQAPQPRGLSELSVEQQERAIMEDLLYV
LMGYEGSYIRYAKGFDAHEERDCLAGPRFSVLPGLDASLHELTQSILAMATHYSALVTFCHVQGRQEFGSVNHAL
CASMRRMLHDYIVMVVQLEREFVTSDSFTIYLLKVHTIPTQHMMAQLYSLAQELLKKSGLLDDDESSDDDDGGDD
DDDDDYDKVIERLADGGELLPGSMAGGKLCKGGLVLGILTRRLETMAGDGAARALLTTLLREASRPYMVMLNEWL
HRGAIKDVHSEFLIKEQRSIKRERLEQDYTDEYWERRYTMRDHDVPPQLAPVKDKVLLAGKYLNVVRECGGVDVT
KAVGDHVPQTIDDAAFLDNVNAAYAHANRSLMQLLLTTHALPARLRSIKRYLFLDPADYLSYFLELGASELRKPV
RLVNTPKLQSLLDVVLRQPGSLVALDPFKEDVKVEMNEVTLVRSLQRVVNITGIDQLDGLQPTALLAQPAEADRR
ADADKKVTGFASLQLDYAVPFPVSLVISRKTVWRYQALFRYLVSLRHLEAQLASTWQTQTRSVAWAHRAPNHSLE
VWKRRAWTLRARMQDFVQQLLYFCTTEVIEPNWSRFMATLSHDGDASGRPMRTVDQLMQDHVDFLDTCLKECMLT
NSKLLRIHSKLMQTCTMFAAYTHWLTRELEKADPHLSSTNRPDTMSPDQWRRFQATKRASALNPEEPPAAHPDMA
SLGNLSEIIRKWEINFSRHLQILLDALNHYAATETVVLLSLCARLSTANQGTEYAGPRTDDDGPSTI*
Coding >OphauG2|1103
ATGGAAGCGGGCTCATGGACAGGAGCGAATCGCGGCCAAGGCGGTGTCTCGCCGCGGGGAGACAGCCAGCATGGA
AGCACGTGGGGCCACAGGCCACGAGGACTTAGCACGAGTGAACGACGATACTCGGAGCGGCGGGTGACGGAGCGG
ACATTGGAAGCACGTATTGAGCGAGTGCGGAGGACAAGCCCGGGCAGGCGACAGGCGCGGCGGAGCGGGGGGAGA
GTGGAAAAGAAAAGCCCGTCGCCGTCGCCGTCGCGCGACACGGTTCCTGCGGCAGCATGGCAGCCCGAGACAATG
CTGCTGGCGCACACGTCGGCTCCATTGGCAAGGAGAATATCACTGCCGCCGCAGGCATCGACGGTGCCACAGGCG
CCTCAGCCGCGGGGGCTGAGCGAGCTGTCGGTGGAGCAGCAAGAGAGGGCCATTATGGAGGATCTGCTCTACGTG
CTCATGGGGTACGAGGGCAGCTACATACGCTACGCCAAGGGCTTCGACGCCCATGAAGAGCGCGATTGCCTGGCG
GGCCCCAGGTTCAGCGTGCTGCCGGGGCTTGACGCCAGCCTGCACGAGCTGACCCAGTCGATACTGGCCATGGCG
ACGCATTACTCGGCCCTCGTCACCTTTTGCCACGTACAGGGGCGACAAGAGTTTGGCAGCGTCAACCACGCGCTG
TGTGCGTCGATGCGGCGGATGCTGCACGACTACATTGTCATGGTTGTGCAGCTCGAGAGGGAGTTTGTGACGAGC
GACTCGTTTACCATTTACCTGCTCAAGGTGCACACGATTCCCACGCAACACATGATGGCGCAGCTCTACTCGCTG
GCGCAGGAGCTACTCAAGAAGAGCGGGCTGCTGGACGACGATGAGAGCAGCGACGACGATGACGGCGGCGATGAC
GACGATGACGACGACTACGACAAGGTGATTGAGAGGCTGGCCGATGGCGGCGAGCTGCTGCCGGGCAGCATGGCG
GGCGGCAAGCTGTGCAAGGGCGGCCTGGTGCTCGGCATCCTGACGAGGCGGCTCGAGACCATGGCGGGCGACGGA
GCGGCGCGTGCGCTGCTGACGACGCTGCTGCGAGAGGCCAGCCGGCCGTACATGGTGATGCTCAACGAATGGCTG
CACCGCGGCGCCATCAAGGACGTGCACTCCGAGTTCCTCATCAAGGAACAGCGCAGCATCAAGCGCGAGCGGCTG
GAGCAGGACTACACCGACGAGTACTGGGAGCGGCGCTACACGATGCGCGACCACGATGTGCCGCCGCAGCTGGCG
CCCGTCAAGGACAAGGTGCTGCTGGCGGGAAAGTACCTCAACGTGGTGCGCGAGTGCGGCGGCGTCGACGTGACC
AAGGCCGTGGGCGACCATGTGCCACAGACGATTGACGACGCCGCCTTTCTCGACAATGTCAATGCCGCCTATGCC
CATGCCAACCGCTCCCTCATGCAGCTGCTGCTGACGACGCACGCCCTGCCCGCGCGCCTGCGCTCCATCAAGCGC
TACCTGTTCCTCGATCCCGCCGACTACCTGTCCTACTTCCTCGAGCTGGGCGCGTCGGAGCTGCGCAAGCCCGTG
CGCCTCGTCAATACGCCCAAGCTGCAGTCGCTGCTCGATGTCGTGCTGCGCCAGCCCGGCAGCTTGGTGGCCCTC
GATCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGGTGACGCTGGTGCGCTCGCTACAGCGCGTCGTCAAC
ATTACCGGCATTGACCAGCTCGACGGCCTGCAACCGACCGCCCTCTTGGCCCAGCCTGCCGAAGCCGACCGCCGC
GCCGACGCCGACAAGAAGGTGACGGGCTTTGCCTCGCTCCAGCTCGACTACGCCGTGCCATTTCCCGTATCTCTC
GTCATCAGCCGCAAGACCGTCTGGCGCTACCAGGCCCTCTTCCGCTACCTCGTCTCCCTGCGCCACCTTGAGGCC
CAGCTCGCCTCCACCTGGCAGACGCAGACACGCTCCGTCGCCTGGGCTCACCGCGCCCCCAACCACTCCCTCGAG
GTCTGGAAGCGCCGCGCCTGGACCCTGCGCGCCCGCATGCAAGACTTTGTCCAGCAGCTCCTCTACTTCTGCACC
ACCGAGGTCATTGAGCCCAACTGGTCCCGTTTCATGGCCACTCTCAGCCATGACGGAGACGCCTCGGGCCGCCCC
ATGAGGACCGTTGACCAGCTCATGCAGGACCACGTCGACTTTCTCGACACTTGCCTCAAGGAGTGTATGCTCACC
AACAGCAAGCTTCTTCGCATTCACTCCAAACTCATGCAGACTTGCACCATGTTCGCCGCCTACACCCACTGGCTC
ACCCGTGAACTCGAAAAGGCCGACCCCCATCTCTCGAGCACAAATAGACCCGACACCATGTCGCCCGACCAGTGG
CGTCGCTTCCAGGCCACTAAACGTGCATCGGCCCTCAACCCCGAAGAACCCCCCGCCGCCCACCCAGATATGGCC
AGCCTCGGCAACCTGTCGGAAATCATTCGCAAGTGGGAAATTAACTTTAGCCGCCACCTGCAGATCCTCCTCGAC
GCCCTCAACCACTACGCCGCCACAGAGACGGTTGTCCTGCTCAGCCTGTGTGCTCGTCTCAGCACTGCAAATCAA
GGCACCGAGTATGCAGGCCCGCGTACCGACGACGATGGGCCTTCTACTATTTGA
Transcript >OphauG2|1103
ATGGAAGCGGGCTCATGGACAGGAGCGAATCGCGGCCAAGGCGGTGTCTCGCCGCGGGGAGACAGCCAGCATGGA
AGCACGTGGGGCCACAGGCCACGAGGACTTAGCACGAGTGAACGACGATACTCGGAGCGGCGGGTGACGGAGCGG
ACATTGGAAGCACGTATTGAGCGAGTGCGGAGGACAAGCCCGGGCAGGCGACAGGCGCGGCGGAGCGGGGGGAGA
GTGGAAAAGAAAAGCCCGTCGCCGTCGCCGTCGCGCGACACGGTTCCTGCGGCAGCATGGCAGCCCGAGACAATG
CTGCTGGCGCACACGTCGGCTCCATTGGCAAGGAGAATATCACTGCCGCCGCAGGCATCGACGGTGCCACAGGCG
CCTCAGCCGCGGGGGCTGAGCGAGCTGTCGGTGGAGCAGCAAGAGAGGGCCATTATGGAGGATCTGCTCTACGTG
CTCATGGGGTACGAGGGCAGCTACATACGCTACGCCAAGGGCTTCGACGCCCATGAAGAGCGCGATTGCCTGGCG
GGCCCCAGGTTCAGCGTGCTGCCGGGGCTTGACGCCAGCCTGCACGAGCTGACCCAGTCGATACTGGCCATGGCG
ACGCATTACTCGGCCCTCGTCACCTTTTGCCACGTACAGGGGCGACAAGAGTTTGGCAGCGTCAACCACGCGCTG
TGTGCGTCGATGCGGCGGATGCTGCACGACTACATTGTCATGGTTGTGCAGCTCGAGAGGGAGTTTGTGACGAGC
GACTCGTTTACCATTTACCTGCTCAAGGTGCACACGATTCCCACGCAACACATGATGGCGCAGCTCTACTCGCTG
GCGCAGGAGCTACTCAAGAAGAGCGGGCTGCTGGACGACGATGAGAGCAGCGACGACGATGACGGCGGCGATGAC
GACGATGACGACGACTACGACAAGGTGATTGAGAGGCTGGCCGATGGCGGCGAGCTGCTGCCGGGCAGCATGGCG
GGCGGCAAGCTGTGCAAGGGCGGCCTGGTGCTCGGCATCCTGACGAGGCGGCTCGAGACCATGGCGGGCGACGGA
GCGGCGCGTGCGCTGCTGACGACGCTGCTGCGAGAGGCCAGCCGGCCGTACATGGTGATGCTCAACGAATGGCTG
CACCGCGGCGCCATCAAGGACGTGCACTCCGAGTTCCTCATCAAGGAACAGCGCAGCATCAAGCGCGAGCGGCTG
GAGCAGGACTACACCGACGAGTACTGGGAGCGGCGCTACACGATGCGCGACCACGATGTGCCGCCGCAGCTGGCG
CCCGTCAAGGACAAGGTGCTGCTGGCGGGAAAGTACCTCAACGTGGTGCGCGAGTGCGGCGGCGTCGACGTGACC
AAGGCCGTGGGCGACCATGTGCCACAGACGATTGACGACGCCGCCTTTCTCGACAATGTCAATGCCGCCTATGCC
CATGCCAACCGCTCCCTCATGCAGCTGCTGCTGACGACGCACGCCCTGCCCGCGCGCCTGCGCTCCATCAAGCGC
TACCTGTTCCTCGATCCCGCCGACTACCTGTCCTACTTCCTCGAGCTGGGCGCGTCGGAGCTGCGCAAGCCCGTG
CGCCTCGTCAATACGCCCAAGCTGCAGTCGCTGCTCGATGTCGTGCTGCGCCAGCCCGGCAGCTTGGTGGCCCTC
GATCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGGTGACGCTGGTGCGCTCGCTACAGCGCGTCGTCAAC
ATTACCGGCATTGACCAGCTCGACGGCCTGCAACCGACCGCCCTCTTGGCCCAGCCTGCCGAAGCCGACCGCCGC
GCCGACGCCGACAAGAAGGTGACGGGCTTTGCCTCGCTCCAGCTCGACTACGCCGTGCCATTTCCCGTATCTCTC
GTCATCAGCCGCAAGACCGTCTGGCGCTACCAGGCCCTCTTCCGCTACCTCGTCTCCCTGCGCCACCTTGAGGCC
CAGCTCGCCTCCACCTGGCAGACGCAGACACGCTCCGTCGCCTGGGCTCACCGCGCCCCCAACCACTCCCTCGAG
GTCTGGAAGCGCCGCGCCTGGACCCTGCGCGCCCGCATGCAAGACTTTGTCCAGCAGCTCCTCTACTTCTGCACC
ACCGAGGTCATTGAGCCCAACTGGTCCCGTTTCATGGCCACTCTCAGCCATGACGGAGACGCCTCGGGCCGCCCC
ATGAGGACCGTTGACCAGCTCATGCAGGACCACGTCGACTTTCTCGACACTTGCCTCAAGGAGTGTATGCTCACC
AACAGCAAGCTTCTTCGCATTCACTCCAAACTCATGCAGACTTGCACCATGTTCGCCGCCTACACCCACTGGCTC
ACCCGTGAACTCGAAAAGGCCGACCCCCATCTCTCGAGCACAAATAGACCCGACACCATGTCGCCCGACCAGTGG
CGTCGCTTCCAGGCCACTAAACGTGCATCGGCCCTCAACCCCGAAGAACCCCCCGCCGCCCACCCAGATATGGCC
AGCCTCGGCAACCTGTCGGAAATCATTCGCAAGTGGGAAATTAACTTTAGCCGCCACCTGCAGATCCTCCTCGAC
GCCCTCAACCACTACGCCGCCACAGAGACGGTTGTCCTGCTCAGCCTGTGTGCTCGTCTCAGCACTGCAAATCAA
GGCACCGAGTATGCAGGCCCGCGTACCGACGACGATGGGCCTTCTACTATTTGA
Gene >OphauG2|1103
ATGGAAGCGGGCTCATGGACAGGAGCGAATCGCGGCCAAGGCGGTGTCTCGCCGCGGGGAGACAGCCAGCATGGA
AGCACGTGGGGCCACAGGCCACGAGGACTTAGCACGAGTGAACGACGATACTCGGAGCGGCGGGTGACGGAGCGG
ACATTGGAAGCACGTATTGAGCGAGTGCGGAGGACAAGCCCGGGCAGGCGACAGGCGCGGCGGAGCGGGGGGAGA
GTGGAAAAGAAAAGCCCGTCGCCGTCGCCGTCGCGCGACACGGTTCCTGCGGCAGCATGGCAGCCCGAGACAATG
CTGCTGGCGCACACGTCGGCTCCATTGGCAAGGAGAATATCACTGCCGCCGCAGGCATCGACGGTGCCACAGGCG
CCTCAGCCGCGGGGGCTGAGCGAGCTGTCGGTGGAGCAGCAAGAGAGGGCCATTATGGAGGATCTGCTCTACGTG
CTCATGGGGTACGAGGGCAGCTACATACGCTACGCCAAGGGCTTCGACGCCCATGAAGAGCGCGATTGCCTGGCG
GGCCCCAGGTTCAGCGTGCTGCCGGGGCTTGACGCCAGCCTGCACGAGCTGACCCAGTCGATACTGGCCATGGCG
ACGCATTACTCGGCCCTCGTCACCTTTTGCCACGTACAGGGGCGACAAGAGTTTGGCAGCGTCAACCACGCGCTG
TGTGCGTCGATGCGGCGGATGCTGCACGACTACATTGTCATGGTTGTGCAGCTCGAGAGGGAGTTTGTGACGAGC
GACTCGTTTACCATTTACCTGCTCAAGGTGCACACGATTCCCACGCAACACATGATGGCGCAGCTCTACTCGCTG
GCGCAGGAGCTACTCAAGAAGAGCGGGCTGCTGGACGACGATGAGAGCAGCGACGACGATGACGGCGGCGATGAC
GACGATGACGACGACTACGACAAGGTGATTGAGAGGCTGGCCGATGGCGGCGAGCTGCTGCCGGGCAGCATGGCG
GGCGGCAAGCTGTGCAAGGGCGGCCTGGTGCTCGGCATCCTGACGAGGCGGCTCGAGACCATGGCGGGCGACGGA
GCGGCGCGTGCGCTGCTGACGACGCTGCTGCGAGAGGCCAGCCGGCCGTACATGGTGATGCTCAACGAATGGCTG
CACCGCGGCGCCATCAAGGACGTGCACTCCGAGTTCCTCATCAAGGAACAGCGCAGCATCAAGCGCGAGCGGCTG
GAGCAGGACTACACCGACGAGTACTGGGAGCGGCGCTACACGATGCGCGACCACGATGTGCCGCCGCAGCTGGCG
CCCGTCAAGGACAAGGTGCTGCTGGCGGGAAAGTACCTCAACGTGGTGCGCGAGTGCGGCGGCGTCGACGTGACC
AAGGCCGTGGGCGACCATGTGCCACAGACGATTGACGACGCCGCCTTTCTCGACAATGTCAATGCCGCCTATGCC
CATGCCAACCGCTCCCTCATGCAGCTGCTGCTGACGACGCACGCCCTGCCCGCGCGCCTGCGCTCCATCAAGCGC
TACCTGTTCCTCGATCCCGCCGACTACCTGTCCTACTTCCTCGAGCTGGGCGCGTCGGAGCTGCGCAAGCCCGTG
CGCCTCGTCAATACGCCCAAGCTGCAGTCGCTGCTCGATGTCGTGCTGCGCCAGCCCGGCAGCTTGGTGGCCCTC
GATCCCTTCAAGGAGGACGTCAAGGTGGAGATGAACGAGGTGACGCTGGTGCGCTCGCTACAGCGCGTCGTCAAC
ATTACCGGCATTGACCAGCTCGACGGCCTGCAACCGACCGCCCTCTTGGCCCAGCCTGCCGAAGCCGACCGCCGC
GCCGACGCCGACAAGAAGGTGACGGGCTTTGCCTCGCTCCAGCTCGACTACGCCGTGCCATTTCCCGTATCTCTC
GTCATCAGCCGCAAGACCGTCTGGCGCTACCAGGCCCTCTTCCGCTACCTCGTCTCCCTGCGCCACCTTGAGGCC
CAGCTCGCCTCCACCTGGCAGACGCAGACACGCTCCGTCGCCTGGGCTCACCGCGCCCCCAACCACTCCCTCGAG
GTCTGGAAGCGCCGCGCCTGGACCCTGCGCGCCCGCATGCAAGACTTTGTCCAGCAGCTCCTCTACTTCTGCACC
ACCGAGGTCATTGAGCCCAACTGGTCCCGTTTCATGGCCACTCTCAGCCATGACGGAGACGCCTCGGGCCGCCCC
ATGAGGACCGTTGACCAGCTCATGCAGGACCACGTCGACTTTCTCGACACTTGCCTCAAGGAGTGTATGCTCACC
AACAGCAAGCTTCTTCGCGTAAGTCGCCTCCCCGAGCTCCCGCTGCTGCCATCTCTCTCTCTCTCTCTCTAACCC
TCTCGTCTTGTTTTACTCGCGCCCTAGATTCACTCCAAACTCATGCAGACTTGCACCATGTTCGCCGCCTACACC
CACTGGCTCACCCGTGAACTCGAAAAGGCCGACCCCCATCTCTCGAGCACAAATAGACCCGACACCATGTCGCCC
GACCAGTGGCGTCGCTTCCAGGCCACTAAACGTGCATCGGCCCTCAACCCCGAAGAACCCCCCGCCGCCCACCCA
GATATGGCCAGCCTCGGCAACCTGTCGGAAATCATTCGCAAGTGGGAAATTAACTTTAGCCGCCACCTGCAGATC
CTCCTCGACGCCCTCAACCACTACGCCGCCACAGAGACGGTTGTCCTGCTCAGCCTGTGTGCTCGTCTCAGCACT
GCAAATCAAGGCACCGAGTATGCAGGCCCGCGTACCGACGACGATGGGCCTTCTACTATTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail