Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|110
Gene name
LocationContig_101:10981..12591
Strand+
Gene length (bp)1610
Transcript length (bp)1251
Coding sequence length (bp)1251
Protein length (aa) 417

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00649 Copper-fist Copper fist DNA binding domain 5.8E-22 1 39

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P45815|CRF1_YARLI Copper resistance protein CRF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CRF1 PE=3 SV=1 1 99 1.0E-23
sp|P15315|CUP2_YEAST Transcriptional activator protein CUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP2 PE=1 SV=1 1 98 9.0E-18
sp|Q09728|CUF1_SCHPO Metal-binding regulatory protein cuf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf1 PE=1 SV=1 1 67 6.0E-16
sp|Q12753|HAA1_YEAST Transcriptional activator HAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAA1 PE=1 SV=1 1 91 1.0E-15
sp|P41772|AMT1_CANGA Metal-activated transcriptional activator protein AMT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AMT1 PE=1 SV=1 1 97 2.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P45815|CRF1_YARLI Copper resistance protein CRF1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=CRF1 PE=3 SV=1 1 99 1.0E-23
sp|P15315|CUP2_YEAST Transcriptional activator protein CUP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CUP2 PE=1 SV=1 1 98 9.0E-18
sp|Q09728|CUF1_SCHPO Metal-binding regulatory protein cuf1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf1 PE=1 SV=1 1 67 6.0E-16
sp|Q12753|HAA1_YEAST Transcriptional activator HAA1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAA1 PE=1 SV=1 1 91 1.0E-15
sp|P41772|AMT1_CANGA Metal-activated transcriptional activator protein AMT1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=AMT1 PE=1 SV=1 1 97 2.0E-14
sp|O94588|CUF2_SCHPO Copper-binding regulatory protein cuf2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cuf2 PE=2 SV=1 1 60 8.0E-11
sp|Q5AFK0|MAC1_CANAL Metal-binding activator 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAC1 PE=2 SV=1 1 38 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003677 DNA binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0003700 DNA-binding transcription factor activity Yes
GO:0005507 copper ion binding Yes
GO:0003676 nucleic acid binding No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0050789 regulation of biological process No
GO:1901363 heterocyclic compound binding No
GO:0046872 metal ion binding No
GO:0031323 regulation of cellular metabolic process No
GO:0043167 ion binding No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0050794 regulation of cellular process No
GO:0080090 regulation of primary metabolic process No
GO:0008150 biological_process No
GO:0140110 transcription regulator activity No
GO:0009889 regulation of biosynthetic process No
GO:0065007 biological regulation No
GO:0005488 binding No
GO:0046914 transition metal ion binding No
GO:0003674 molecular_function No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0097159 organic cyclic compound binding No
GO:0043169 cation binding No
GO:0051252 regulation of RNA metabolic process No
GO:0031326 regulation of cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|110
MLINGEKFACEACVRGHRVSNCQHSDRPLQHINKKGRPVSQCQHCRTMRKSRSAHVKCDCGEKTSKCAHLQQPVQ
GHKETCCCNHGGRCTCAHKKDTSLGTVPESDSDHDAQAAPHPGRPKASRRRRANTAHSADAIMSFDRNGHHKPTA
KHNRSAQKSSPYQLNRVNSTQSVSSLGGSESISYHLDGDAQSSNGRSRASTLHEQRKAKSETASPLLSGSALAQL
NGTLPPLDLTRIEYSSYVHNGTFEMFAASGLAENDTPMYSAGLSAASVDWSHYDLGDTKGDFAPSSYSQTGAPSF
NGFVELGSGSDQPPNLTNTRSTSGNVSEVEDFVANGDDLNGLLRQNTASSISADISTIDYDSFYKGSDNPNATIA
AISMVDEDPAFWMSNYNDAMAVVDESSDALAASGLGSFWDM*
Coding >OphauG2|110
ATGTTGATAAACGGAGAAAAGTTTGCCTGCGAGGCCTGCGTCAGAGGACACCGCGTGAGCAATTGCCAGCACAGT
GACCGCCCACTTCAACACATCAATAAAAAGGGCCGTCCAGTCTCACAATGCCAACACTGCCGCACCATGCGCAAG
TCGCGCTCAGCACACGTCAAGTGCGACTGCGGCGAAAAGACGAGCAAGTGTGCCCATCTGCAACAGCCCGTCCAA
GGACACAAGGAAACCTGCTGCTGCAATCATGGCGGTCGCTGCACCTGCGCCCACAAAAAGGACACCTCTCTGGGA
ACCGTGCCCGAGTCCGACTCGGATCACGACGCTCAAGCCGCCCCTCACCCAGGTCGCCCTAAAGCCTCGAGAAGG
AGGCGCGCCAATACGGCCCACTCTGCAGACGCCATCATGTCTTTTGATCGCAACGGCCACCACAAGCCTACCGCC
AAGCATAATCGGTCTGCTCAAAAATCGAGCCCCTATCAGCTCAATCGCGTCAATTCAACACAGAGTGTCAGCAGC
CTTGGGGGCTCAGAGTCCATTTCGTACCACCTGGATGGTGATGCTCAATCATCCAACGGCCGCTCCCGCGCCTCC
ACGTTGCATGAACAGCGCAAAGCCAAATCCGAAACTGCCTCACCCTTACTGTCCGGGTCTGCCCTGGCCCAGCTC
AACGGCACACTGCCGCCACTGGACCTGACACGCATTGAGTACTCGTCCTATGTCCACAATGGCACCTTTGAAATG
TTTGCCGCCTCTGGTCTTGCAGAAAACGACACACCCATGTACAGTGCTGGCTTGAGCGCAGCTTCCGTCGACTGG
AGCCACTATGACCTTGGCGATACCAAGGGCGATTTTGCCCCGTCGAGCTACAGCCAAACTGGAGCTCCGAGTTTC
AACGGTTTTGTTGAATTGGGAAGTGGCTCGGACCAGCCTCCCAATCTGACCAATACAAGGTCCACGTCGGGAAAT
GTATCCGAGGTTGAAGACTTTGTTGCCAATGGAGACGATCTGAACGGCCTTCTCCGTCAAAATACCGCTTCCAGT
ATTTCCGCCGATATCAGCACCATTGACTACGATAGCTTCTACAAGGGCTCTGACAACCCCAATGCCACGATTGCA
GCAATCTCCATGGTGGACGAGGACCCTGCTTTCTGGATGTCCAACTATAACGACGCCATGGCTGTCGTGGACGAG
AGTTCAGATGCCCTCGCCGCCTCTGGCCTTGGTAGCTTTTGGGATATGTAA
Transcript >OphauG2|110
ATGTTGATAAACGGAGAAAAGTTTGCCTGCGAGGCCTGCGTCAGAGGACACCGCGTGAGCAATTGCCAGCACAGT
GACCGCCCACTTCAACACATCAATAAAAAGGGCCGTCCAGTCTCACAATGCCAACACTGCCGCACCATGCGCAAG
TCGCGCTCAGCACACGTCAAGTGCGACTGCGGCGAAAAGACGAGCAAGTGTGCCCATCTGCAACAGCCCGTCCAA
GGACACAAGGAAACCTGCTGCTGCAATCATGGCGGTCGCTGCACCTGCGCCCACAAAAAGGACACCTCTCTGGGA
ACCGTGCCCGAGTCCGACTCGGATCACGACGCTCAAGCCGCCCCTCACCCAGGTCGCCCTAAAGCCTCGAGAAGG
AGGCGCGCCAATACGGCCCACTCTGCAGACGCCATCATGTCTTTTGATCGCAACGGCCACCACAAGCCTACCGCC
AAGCATAATCGGTCTGCTCAAAAATCGAGCCCCTATCAGCTCAATCGCGTCAATTCAACACAGAGTGTCAGCAGC
CTTGGGGGCTCAGAGTCCATTTCGTACCACCTGGATGGTGATGCTCAATCATCCAACGGCCGCTCCCGCGCCTCC
ACGTTGCATGAACAGCGCAAAGCCAAATCCGAAACTGCCTCACCCTTACTGTCCGGGTCTGCCCTGGCCCAGCTC
AACGGCACACTGCCGCCACTGGACCTGACACGCATTGAGTACTCGTCCTATGTCCACAATGGCACCTTTGAAATG
TTTGCCGCCTCTGGTCTTGCAGAAAACGACACACCCATGTACAGTGCTGGCTTGAGCGCAGCTTCCGTCGACTGG
AGCCACTATGACCTTGGCGATACCAAGGGCGATTTTGCCCCGTCGAGCTACAGCCAAACTGGAGCTCCGAGTTTC
AACGGTTTTGTTGAATTGGGAAGTGGCTCGGACCAGCCTCCCAATCTGACCAATACAAGGTCCACGTCGGGAAAT
GTATCCGAGGTTGAAGACTTTGTTGCCAATGGAGACGATCTGAACGGCCTTCTCCGTCAAAATACCGCTTCCAGT
ATTTCCGCCGATATCAGCACCATTGACTACGATAGCTTCTACAAGGGCTCTGACAACCCCAATGCCACGATTGCA
GCAATCTCCATGGTGGACGAGGACCCTGCTTTCTGGATGTCCAACTATAACGACGCCATGGCTGTCGTGGACGAG
AGTTCAGATGCCCTCGCCGCCTCTGGCCTTGGTAGCTTTTGGGATATGTAA
Gene >OphauG2|110
ATGTTGATAAACGGAGAAAAGTTTGCCTGCGAGGCCTGCGTCAGAGGACACCGCGTGAGCAATTGCCAGCACAGT
GGTCAGTCTTGCCCTTGGCCAGCATCATGTTTGCGCTCTTCTGGATGATGCTACTCTGCGTCGCGACCCCTCTAT
TACCCCCCGCCCCCCTTCCTTTTTGCACCACCGCTCCAGCCGCCTCTTACAGAGCATACATGCAATTGCTGACGC
CGTCCCTGGCGAGCCACGATAGACCGCCCACTTCAACACATCAATAAAAAGGGCCGTCCAGTCTCACAATGCCAA
CACTGCCGCACCATGCGCAAGTCGCGCTCAGCACACGTCAAGTGCGACTGCGGCGAAAAGACGAGCAAGTGTGCC
CATCTGCAACAGCCCGTCCAAGGACACAAGGGTCAGTAGTCGCACTAGTCCACTGTCCGTTTTTGCCTTTCTTTT
TTTTTTCCTTTTTTTTCTCTTTTTTTTTTCTCTTCTTTTTTGCCCTTCTTTTTTTCCTTTTCTGCCACCCAAAAA
AAAACCCCCCAAAAAAACCAAAAAAAAAAAAAAAAAAAAAAAAAAACTCTTGTCCTGACACCTCTCAAGAAACCT
GCTGCTGCAATCATGGCGGTCGCTGCACCTGCGCCCACAAAAAGGACACCTCTCTGGGAACCGTGCCCGAGTCCG
ACTCGGATCACGACGCTCAAGCCGCCCCTCACCCAGGTCGCCCTAAAGCCTCGAGAAGGAGGCGCGCCAATACGG
CCCACTCTGCAGACGCCATCATGTCTTTTGATCGCAACGGCCACCACAAGCCTACCGCCAAGCATAATCGGTCTG
CTCAAAAATCGAGCCCCTATCAGCTCAATCGCGTCAATTCAACACAGAGTGTCAGCAGCCTTGGGGGCTCAGAGT
CCATTTCGTACCACCTGGATGGTGATGCTCAATCATCCAACGGCCGCTCCCGCGCCTCCACGTTGCATGAACAGC
GCAAAGCCAAATCCGAAACTGCCTCACCCTTACTGTCCGGGTCTGCCCTGGCCCAGCTCAACGGCACACTGCCGC
CACTGGACCTGACACGCATTGAGTACTCGTCCTATGTCCACAATGGCACCTTTGAAATGTTTGCCGCCTCTGGTC
TTGCAGAAAACGACACACCCATGTACAGTGCTGGCTTGAGCGCAGCTTCCGTCGACTGGAGCCACTATGACCTTG
GCGATACCAAGGGCGATTTTGCCCCGTCGAGCTACAGCCAAACTGGAGCTCCGAGTTTCAACGGTTTTGTTGAAT
TGGGAAGTGGCTCGGACCAGCCTCCCAATCTGACCAATACAAGGTCCACGTCGGGAAATGTATCCGAGGTTGAAG
ACTTTGTTGCCAATGGAGACGATCTGAACGGCCTTCTCCGTCAAAATACCGCTTCCAGTATTTCCGCCGATATCA
GCACCATTGACTACGATAGCTTCTACAAGGGCTCTGACAACCCCAATGCCACGATTGCAGCAATCTCCATGGTGG
ACGAGGACCCTGCTTTCTGGATGTCCAACTATAACGACGCCATGGCTGTCGTGGACGAGAGTTCAGATGCCCTCG
CCGCCTCTGGCCTTGGTAGCTTTTGGGATATGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail