Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1096
Gene name
LocationContig_130:17164..26399
Strand+
Gene length (bp)9235
Transcript length (bp)8994
Coding sequence length (bp)8994
Protein length (aa) 2998

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12340 DUF3638 Protein of unknown function (DUF3638) 6.0E-88 1884 2106
PF20255 DUF6606 Family of unknown function (DUF6606) 2.6E-40 2 143
PF12359 DUF3645 Protein of unknown function (DUF3645) 8.8E-16 2227 2258

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup26
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2844
Ophiocordyceps australis 1348a (Ghana) OphauG2|182
Ophiocordyceps australis 1348a (Ghana) OphauG2|1096 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|4129
Ophiocordyceps australis map64 (Brazil) OphauB2|1080
Ophiocordyceps australis map64 (Brazil) OphauB2|1081
Ophiocordyceps australis map64 (Brazil) OphauB2|1082
Ophiocordyceps australis map64 (Brazil) OphauB2|198
Ophiocordyceps australis map64 (Brazil) OphauB2|199
Ophiocordyceps australis map64 (Brazil) OphauB2|200
Ophiocordyceps australis map64 (Brazil) OphauB2|4128
Ophiocordyceps australis map64 (Brazil) OphauB2|697
Ophiocordyceps camponoti-floridani Ophcf2|06472
Ophiocordyceps camponoti-rufipedis Ophun1|2805
Ophiocordyceps camponoti-rufipedis Ophun1|7356
Ophiocordyceps camponoti-rufipedis Ophun1|5691
Ophiocordyceps kimflemingae Ophio5|1382
Ophiocordyceps kimflemingae Ophio5|4085
Ophiocordyceps kimflemingae Ophio5|6746
Ophiocordyceps kimflemingae Ophio5|7262
Ophiocordyceps subramaniannii Hirsu2|7620
Ophiocordyceps subramaniannii Hirsu2|7186
Ophiocordyceps subramaniannii Hirsu2|4583
Ophiocordyceps subramaniannii Hirsu2|4582
Ophiocordyceps subramaniannii Hirsu2|296

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1096
MDWIFPGSAVEVPFTTFRDESFTNNLALFIQKASEETLSRFSARAIKSGSSIIENRDPPHPGLISQFLMALLGAV
GNFVEVPELRKRVRDDINFGKGEMPWRRCPSWLVLRVAMQRQLGLVLGQDLGRAAYKLVICAILEQLLDACAGVL
SPELTIMLKAKLCRRLAKLERLREQSPELLSSFLEQAFSAVATKSQRTVEKATNQVETAWKQYKVSITRTIPHLP
CRANDDALRLSLHNSQHHLQQLLKQPFKNTRHAPCENPYVKDDTEDQMRNLAKFSSQLETLEARLHMQILDDEFP
ESQQKLELRCISFCDSIYDLFTLVDDAFLGKPDQMSLLILRLLELWVQLDKSACKICPLLFDYSILFRPEALDVL
HLARISEMQRLQTVQLYLSERQQRCGASANSIYSEPSLGSFAVRYLDESEDGPRLCTLLDRISAASQRAQNSKDA
EWKQLCREYDSLTDKIASATCLCTIQQDGQRDVRGCNKCWYWRCRKRMTISAHEDYLPQGRPEKAAVVFELGIPK
YLQQYRNATWRIFRKLGYPGAKTDASNAIMLLKDYEQLKEYKAATCNGISLASSVKSFLQTHYARVKMKADAASV
FLPHGPVFHYYDQTNREWLKDLSAPASFQHHCGFSLPRALLDASIRNPRHPAWNDGPSSYETVASLTKCPRGMSS
HEFMAVQRLIGGKNRRWLTMLVELGSSNINMSDEESLCLMTELAVQAGPLAETSDVLRDVHVVFRDDEFCQRLSE
QINKRLGMIKANWRETHCMDFMVTLALRLHSLGGASARLEAEKALQTARETILTWVMSLRTNCRTEQNAEAAKRL
SRYAFRAAMICRRTFAIFENTDRLMSGDELSCFIIASVALQQNLMDISALEPKMHGFLMNDLRLAFRLRSVIDKS
ARGYPRHLGEAILKSIRGDLNTTIAERFSQWVFPAALDHYWVAFDMCCLEREGEGAQTVQYHLLEGHLKINGQTL
GRLPVEIMNSNSVKELFGDQNLTTFPSIYGDLSHVLADKLHGYEVHLGMRDGEVVIRARKRFGTFEYIPAKYFYG
SGRNNFDLPEELVVDCAHWLNLDTGILEIRRKPLIWVDRPGNWKINLHNGKAFRRESKLVDPRSVLCQQIYAIYS
GFEQPQRLTVFQPRMGSLSVFLHRLKLTFNVNGKNLLECRELKCEIDPNQDAGTLYGLQSKLVLRDSDNTGRRSI
LAGLGHLVYQRRGMHVAVGTRDITAYARYEIDAVLGRLSCPPEPRLLYSKALFHALTSFVLSDPLTGSTGTEEAY
RILSSGYCQPWKPLHPGTIEHILKEIQGLSPAREYYPPDKRQLQCVSWNPDLTVTIQHDCYHRLVEDILKKSQRL
EVFNGIKYARQPNGDTATNTHLRDRAEIRRSLLERSISETWIMPHQSRTVYKSRDRLAMASTDSNVYKTVALLRQ
ETFSGCLDIRLASMLEQFPNQLIGGFATTSQFASQSLDQLIDGSIGEQWGSLVNYCCASKAKGKFNAIFRLGLLS
FGLNANRDAITFLCAFSIIEELWDIAPPVGDVFRSFKFEERPSIEYLEALIQRTLSKTEPGVKRKKLDNGSASPE
SKENPSKRLILAEYLAKQWPSAQLLYAGLDSLELESLDIDKIQEAVEPEWRRLIDNELLSRYIVEVQSVIDRYSC
QQGPDISIPRNLRLVLEDTAFRIPTDLVPSLAKELLVKQAPKMPELACLGQRLQEATVDRFLEDHDGNSREMFKQ
ENHVMSEVKGLLERFIQSPKPLWQQYGNDLLESYYALQYRRSSKEKVSNPPSLAEIDERINVAERSLVMCLEVLR
GALSANNGVCKWLNMGNMWPRVTPVTVLQLLRTRDKNIFGPGMKELLVAYGTLIATLQWLLRIKREYMRGDEQKL
LEQWNDRGHGNWDPFEYPDWLLLEIESNIFIRPEQVEVAHAIIRPPSSANSLLQLNMGKGKTSCIVPMVVLVLAD
SERLCRLIVPKALTQQAAQILQCRIGGLLGREIRQIPFSRRTPTSSDVQQAYLDLHCQVRDLSGVILAIPEHILS
YKLSGFQRLADGNVKEAHAMFEGQEWLDSTCRDVLDESDFTLAVKTQLIYPSGELVPVDGHPDRWILAQSLLSLV
EERLEDLCSSFPHGIQVLKRRPGFPMIYITHSDVEKALRDSLTEAIIQGRTSFLPVSMSLSNTSIKMLRKLLVED
APERQTFERVKRALAAKPSVYKGLLLARGLLLQGILFLCLRKRWNVQYGLHADRDPIAVPYEAKGVPSAQAEFGH
PDVAILLTCLAFYYSGLTVGQLRDGLGHVLKSDDPGAEYDRWTAGCATLPPGLRQWNLVNVDDSGQVEELWHHLR
LNKSVLDHFMNHFVFPRHAKQFNIKLQSSGWDLPLSWFNGSNPLARTTGFSGTNDNRRLLPLLIQQHDLVSLKHT
SAEVLTYLLEERNRQYTVAKDAQGARLSETELLRTLHGKQIRVLIDAGAYILEMDNRSLVQTWLQIDHEAKAGVY
LGADDNRAWVQYSNGKDAVPLLATPYAENLDGCLVYLDEAHTRGTDLQLPKTTHGALTLALGQTKDHTVQAAMRL
RKLATTQSISFWAPPEVHQSIVESSGKEPNGEFSSIDVVGWLLEQTCRANEQLQGLFIAQGLNFCRRQNAILENP
LFLSSPSQRSAVLNIVRSTEHLTLDELYGNQGGRQNHEPVHGVNSSLQGLVEQLDKQKQVFVHGESSMVANAMDE
VEQEREVEFQVEEVREVQKPKHRKALSFPGLHQSVAAFIQTGVLSAGDGCQEMSVFLAQTALGKQHELEMSGSRL
LVSEQFLRTVETGTNRPIDDNYARPVEWVLWSPGTGVALVVIPEEAEIAMPLIRAMPTPMVHLMTYSAPVTRHML
RFGQLEYYALPSLSTNDATPPWLSIELGIVGARLYFSHDEYEALLKHLKALDGQSSQQTAKGKLLGFVFEWLTVR
RKGQDILHTPMGYVCQGRALGQGHAFFGGGAEAAARLEVRSATASETGHEDPRVSEVEEATQSEEDNDSLEE*
Coding >OphauG2|1096
ATGGATTGGATCTTTCCGGGGAGTGCCGTTGAGGTCCCTTTTACCACTTTTCGAGACGAATCATTCACCAATAAC
CTGGCTCTTTTTATACAAAAGGCCTCCGAGGAGACTCTTTCGCGTTTCTCAGCGCGCGCGATTAAGTCCGGATCG
TCCATTATAGAGAATCGTGATCCTCCTCACCCAGGACTCATCTCCCAGTTCCTTATGGCCTTGCTCGGTGCAGTC
GGGAACTTTGTCGAGGTTCCCGAGCTAAGAAAACGTGTGAGGGATGATATCAATTTTGGAAAAGGCGAAATGCCA
TGGCGACGTTGTCCATCGTGGCTAGTGTTGCGAGTGGCTATGCAACGCCAACTCGGTCTCGTCCTGGGCCAGGAC
TTGGGGCGTGCCGCGTACAAGCTCGTCATTTGCGCCATACTCGAGCAATTGCTCGATGCTTGTGCAGGTGTTTTG
TCGCCTGAGCTAACCATCATGTTAAAAGCCAAACTTTGTCGTCGACTTGCCAAATTGGAGCGACTAAGAGAGCAG
TCGCCAGAGCTCTTGTCGTCCTTTTTAGAACAAGCCTTTTCTGCCGTCGCAACCAAGTCTCAAAGGACGGTTGAA
AAAGCCACAAACCAGGTTGAGACAGCGTGGAAGCAGTACAAAGTGTCGATTACGCGCACCATTCCCCACTTACCC
TGCCGAGCAAATGATGACGCGCTGCGGTTGAGCCTTCACAATAGCCAACATCATTTACAACAGCTTTTGAAGCAG
CCGTTCAAGAACACAAGACATGCTCCTTGCGAAAACCCATACGTCAAGGACGATACAGAGGATCAGATGAGAAAT
CTGGCCAAGTTTTCAAGTCAGCTTGAGACGCTGGAAGCTCGTCTTCACATGCAAATCTTGGATGATGAATTTCCC
GAGAGCCAGCAAAAACTCGAGTTGCGCTGCATATCTTTTTGTGACAGCATTTACGACCTCTTTACACTAGTTGAT
GACGCCTTTCTAGGAAAGCCAGATCAGATGAGCCTTTTAATTCTGAGATTACTCGAACTATGGGTCCAACTAGAC
AAAAGTGCATGCAAAATATGTCCTTTACTTTTCGACTACTCTATATTATTTCGGCCCGAAGCTCTCGATGTACTT
CATCTTGCCCGCATCTCGGAGATGCAGAGACTTCAGACGGTACAACTTTATCTTAGCGAAAGACAACAACGGTGT
GGAGCTTCAGCAAACTCTATCTACAGTGAACCAAGTCTTGGCTCTTTTGCGGTACGCTATCTGGACGAGTCAGAA
GACGGCCCGAGACTATGCACTCTGCTCGATAGAATTTCAGCCGCATCGCAACGCGCGCAAAACTCCAAAGACGCA
GAGTGGAAGCAGTTATGCCGAGAATATGATAGTCTCACCGACAAGATTGCTAGCGCTACTTGCCTCTGCACTATT
CAACAAGACGGCCAGCGAGATGTCCGAGGATGTAACAAGTGCTGGTACTGGCGCTGTCGGAAACGCATGACTATC
AGCGCCCACGAAGACTATCTCCCTCAAGGAAGACCTGAAAAAGCCGCCGTTGTCTTTGAGCTTGGAATCCCAAAG
TACCTGCAGCAATATCGCAACGCCACATGGCGGATATTTCGGAAACTAGGGTATCCAGGAGCCAAAACGGACGCT
TCAAATGCCATAATGCTGCTGAAAGACTATGAGCAGTTAAAGGAATACAAAGCAGCCACCTGTAATGGAATATCT
CTGGCATCCTCGGTCAAGTCGTTTTTGCAGACACATTACGCCAGGGTGAAGATGAAGGCTGATGCAGCAAGTGTT
TTCCTGCCTCATGGCCCGGTTTTTCATTACTACGATCAAACCAATCGTGAATGGCTAAAAGACCTTTCAGCTCCC
GCCTCCTTCCAACACCACTGTGGTTTCAGTCTCCCACGAGCTTTACTAGACGCATCCATTAGAAATCCACGGCAT
CCTGCGTGGAATGATGGACCTTCTTCGTACGAGACAGTGGCCAGTCTAACAAAATGTCCCCGAGGCATGTCGAGC
CATGAGTTCATGGCCGTGCAGCGACTGATTGGAGGCAAGAACCGACGTTGGTTGACGATGCTTGTCGAGCTCGGT
TCTTCAAACATCAACATGAGCGATGAAGAGAGCCTTTGTTTGATGACTGAGCTCGCTGTACAGGCTGGTCCTCTG
GCGGAGACGAGCGACGTTTTGCGGGATGTGCATGTCGTGTTTCGTGACGACGAGTTTTGTCAGCGACTCTCGGAG
CAAATTAACAAGCGCCTTGGCATGATCAAAGCAAACTGGCGGGAAACCCACTGCATGGACTTTATGGTGACGCTT
GCCCTACGTCTTCACAGTCTTGGAGGCGCCAGTGCTCGACTAGAAGCCGAAAAGGCGCTTCAAACTGCGCGTGAG
ACAATTTTAACCTGGGTCATGAGCTTACGCACCAATTGCAGAACGGAGCAGAATGCCGAAGCTGCCAAGCGTCTT
TCCCGATATGCCTTTCGAGCAGCCATGATATGCCGACGCACATTTGCAATTTTTGAGAATACTGACAGGCTAATG
AGTGGAGATGAGTTGAGCTGTTTTATAATAGCCTCTGTTGCTCTACAGCAAAACTTGATGGACATCTCGGCACTT
GAGCCAAAAATGCATGGCTTTTTGATGAATGATTTAAGACTGGCTTTTCGGCTCCGCTCAGTCATTGACAAATCA
GCCCGAGGATACCCAAGACACTTGGGTGAAGCAATTTTAAAGTCTATTCGTGGAGACCTGAACACAACTATTGCA
GAGCGCTTCTCTCAATGGGTGTTTCCAGCAGCGTTGGATCACTACTGGGTTGCCTTTGACATGTGCTGCTTGGAG
CGAGAGGGAGAAGGAGCACAAACAGTACAGTACCATTTACTTGAAGGTCATCTCAAGATCAACGGACAGACACTG
GGGAGGCTTCCAGTGGAAATTATGAACTCCAATAGTGTCAAGGAGCTGTTCGGCGACCAGAATTTGACAACATTT
CCCTCCATTTATGGCGACTTGAGCCACGTTTTGGCTGACAAGTTGCATGGCTACGAGGTTCATCTAGGAATGCGC
GACGGTGAAGTTGTTATCCGAGCCCGCAAACGATTTGGTACTTTTGAGTATATACCCGCAAAGTACTTCTACGGC
TCGGGGAGAAACAATTTTGACCTGCCCGAGGAGCTTGTCGTTGACTGCGCTCACTGGCTTAACCTTGATACTGGA
ATACTTGAAATCCGTCGCAAGCCTTTAATCTGGGTTGATCGGCCAGGCAACTGGAAAATCAATCTCCACAACGGT
AAAGCCTTTCGTCGAGAGTCCAAACTCGTGGACCCAAGATCAGTGCTCTGCCAACAGATTTATGCAATATACTCG
GGCTTTGAGCAGCCTCAGCGACTTACTGTTTTCCAGCCTAGAATGGGCAGCCTATCAGTCTTTTTGCATCGACTT
AAGCTTACATTTAATGTCAACGGAAAGAATCTGCTTGAATGTAGAGAGCTGAAATGTGAGATTGACCCCAACCAG
GATGCGGGAACACTGTACGGGCTACAGAGCAAGCTGGTTCTCCGCGATAGCGACAACACTGGAAGACGAAGCATT
CTTGCTGGGCTGGGGCATCTCGTATATCAGCGTAGAGGCATGCACGTTGCTGTGGGGACCCGAGACATCACGGCG
TATGCTCGATATGAAATCGATGCCGTTCTGGGGCGTCTGTCATGTCCACCCGAGCCGCGCCTTCTCTACTCCAAG
GCCTTGTTCCATGCCCTGACATCTTTTGTCTTGTCAGACCCCTTGACTGGCTCTACGGGCACCGAGGAGGCATAT
CGCATTTTGAGCTCTGGCTACTGTCAGCCGTGGAAGCCGCTGCACCCAGGAACCATTGAGCACATTCTGAAAGAA
ATCCAGGGGTTAAGTCCTGCCAGAGAGTATTATCCGCCAGACAAGAGACAGCTCCAGTGCGTGTCGTGGAACCCA
GATCTCACAGTCACAATCCAGCACGATTGCTACCATAGACTTGTTGAAGATATTCTCAAAAAGTCGCAGCGCCTA
GAGGTTTTTAATGGCATAAAGTATGCTAGACAACCAAATGGGGACACTGCAACAAATACACACCTCAGAGACCGA
GCCGAGATACGACGATCGCTTTTGGAGCGCAGCATTTCAGAGACTTGGATTATGCCACACCAATCTCGCACAGTA
TATAAATCCAGAGACAGGCTTGCCATGGCCTCAACCGATTCAAACGTATACAAGACTGTCGCTTTGTTACGACAA
GAAACATTCTCGGGTTGTCTTGACATTAGACTTGCAAGCATGCTCGAACAATTCCCAAACCAGCTTATAGGAGGG
TTTGCTACCACGTCGCAATTTGCTTCTCAATCTCTCGACCAGCTTATTGACGGCAGCATTGGTGAACAATGGGGT
AGCTTGGTCAATTACTGCTGCGCCTCAAAAGCAAAGGGTAAATTCAATGCTATATTTCGACTGGGTCTACTCTCT
TTTGGCCTGAACGCGAACCGCGACGCAATAACATTTCTCTGTGCGTTTTCCATTATAGAGGAACTATGGGATATT
GCTCCGCCTGTCGGCGATGTTTTCCGGAGCTTTAAATTTGAGGAACGGCCTAGCATTGAATATCTCGAGGCACTC
ATTCAAAGAACTCTAAGCAAAACAGAACCAGGCGTCAAGCGCAAAAAGTTGGACAATGGCTCTGCCTCTCCGGAG
AGTAAAGAAAATCCAAGCAAGAGGCTAATACTAGCTGAGTATTTGGCGAAACAATGGCCAAGTGCCCAGCTATTA
TACGCGGGGCTAGATTCACTTGAGCTAGAGTCACTAGATATCGACAAGATCCAGGAGGCGGTTGAGCCCGAGTGG
CGTCGGCTTATAGACAATGAGCTCCTCTCGAGGTATATTGTTGAGGTTCAGTCGGTAATAGATCGCTATTCCTGC
CAGCAAGGGCCCGATATTTCAATACCTCGAAACTTGAGGTTGGTTCTCGAGGACACGGCGTTCAGGATTCCGACA
GATTTAGTTCCTTCCTTGGCGAAAGAACTCTTGGTCAAACAGGCGCCAAAGATGCCAGAGCTTGCTTGCCTTGGC
CAAAGACTACAAGAGGCTACAGTTGACCGGTTCCTGGAAGACCATGACGGCAACTCTCGAGAAATGTTCAAGCAG
GAAAACCACGTCATGAGTGAGGTCAAAGGGCTGCTTGAGCGCTTTATTCAATCGCCGAAGCCACTTTGGCAACAG
TACGGCAACGATTTGCTCGAAAGTTATTACGCGCTGCAATATAGGAGAAGCAGCAAAGAAAAAGTATCAAATCCA
CCAAGTCTTGCCGAGATTGATGAAAGGATCAATGTGGCTGAAAGGTCGCTGGTGATGTGTCTCGAGGTCCTTCGT
GGAGCCTTGTCAGCAAACAATGGGGTCTGCAAGTGGCTCAACATGGGCAACATGTGGCCGCGAGTGACTCCAGTG
ACTGTACTGCAACTGCTGCGCACGCGGGACAAGAACATTTTTGGTCCAGGCATGAAGGAGCTTCTGGTTGCCTAT
GGGACTTTGATTGCGACTCTGCAGTGGCTGTTGCGGATTAAGCGCGAGTACATGAGAGGAGATGAACAGAAGCTT
CTGGAGCAGTGGAATGATCGGGGCCACGGCAACTGGGACCCCTTTGAGTACCCGGACTGGCTTTTGTTGGAGATT
GAAAGCAACATTTTTATTCGGCCCGAGCAGGTCGAGGTGGCGCATGCCATTATACGGCCGCCATCATCAGCCAAT
TCGCTTCTCCAGCTGAATATGGGCAAAGGCAAAACTTCGTGTATTGTCCCTATGGTTGTCTTGGTATTGGCTGAC
TCTGAAAGGCTCTGTCGGCTCATTGTGCCCAAGGCTTTAACACAGCAAGCAGCTCAGATCCTGCAGTGCCGCATC
GGGGGCCTCTTGGGGCGCGAGATTCGACAGATTCCCTTTTCTCGTCGCACGCCGACATCGAGCGACGTGCAGCAA
GCATACCTTGATTTACACTGCCAAGTCCGCGACTTGAGTGGAGTCATTCTCGCTATACCAGAACACATTCTCTCA
TACAAGCTCAGCGGATTTCAGAGGCTGGCTGATGGGAATGTCAAGGAAGCGCATGCCATGTTTGAGGGCCAAGAA
TGGCTCGACTCGACGTGCCGTGATGTGCTGGATGAATCAGACTTTACGCTGGCTGTCAAGACGCAGCTCATTTAT
CCCAGTGGAGAGTTGGTGCCGGTTGATGGCCACCCCGACCGCTGGATCTTGGCACAGTCTCTGCTTAGTCTGGTA
GAGGAAAGACTTGAAGACCTTTGCAGCAGCTTTCCGCACGGCATACAGGTTCTCAAACGAAGGCCAGGGTTTCCC
ATGATTTACATTACCCATTCAGATGTGGAAAAAGCCTTACGAGACAGCTTGACCGAGGCAATCATTCAGGGCAGG
ACTTCATTTCTGCCAGTCTCCATGAGTCTTTCCAATACATCAATAAAGATGTTGCGGAAGCTGCTTGTGGAAGAC
GCTCCGGAAAGACAAACGTTTGAGCGTGTCAAGAGAGCACTTGCGGCCAAGCCATCCGTCTACAAGGGGCTCTTG
CTCGCCCGCGGCCTGCTGCTACAAGGAATTCTCTTCCTCTGCCTACGCAAGCGATGGAATGTCCAGTATGGCTTA
CATGCAGATCGCGATCCTATTGCGGTTCCTTATGAAGCCAAAGGCGTGCCTTCAGCGCAAGCCGAGTTTGGCCAC
CCTGATGTGGCGATACTGCTCACTTGCCTGGCCTTCTACTACTCTGGTCTGACAGTTGGCCAGTTGCGCGACGGA
TTGGGACATGTTCTCAAGTCGGATGACCCAGGGGCCGAATACGACAGATGGACTGCGGGTTGTGCCACGTTGCCG
CCAGGTCTCCGCCAGTGGAATCTCGTCAATGTGGATGACTCTGGACAGGTTGAAGAACTGTGGCACCATTTGCGC
TTGAACAAGAGTGTCTTGGACCACTTCATGAATCACTTTGTCTTTCCACGTCATGCGAAGCAGTTCAACATTAAG
CTGCAGTCGTCAGGCTGGGACTTGCCACTATCTTGGTTCAATGGCTCAAATCCCTTGGCGAGGACGACGGGCTTT
AGCGGAACAAATGACAATCGACGGCTGCTCCCGCTGCTCATCCAGCAGCATGACTTGGTCTCCTTAAAGCACACC
AGCGCCGAGGTGCTCACGTATTTGTTGGAAGAACGAAACCGACAGTATACCGTTGCCAAGGATGCTCAAGGCGCA
CGCCTTTCTGAGACGGAACTGCTCAGAACATTACATGGCAAACAGATTCGGGTTCTCATTGATGCAGGGGCATAT
ATCCTCGAAATGGACAATAGGAGCCTTGTTCAAACGTGGTTACAGATTGACCACGAGGCCAAAGCAGGCGTCTAT
TTGGGAGCCGACGATAATAGGGCTTGGGTGCAGTATAGCAACGGCAAAGATGCGGTTCCTCTTTTGGCCACGCCC
TATGCGGAAAACCTCGACGGGTGTCTAGTCTACTTGGACGAGGCTCATACCCGTGGTACCGACCTACAGCTGCCC
AAGACGACACATGGAGCGCTTACTCTTGCTCTGGGACAAACCAAGGATCATACTGTTCAAGCCGCCATGAGACTG
CGAAAGCTAGCAACAACCCAGTCGATAAGCTTTTGGGCGCCACCAGAGGTTCATCAGAGCATTGTCGAATCGTCA
GGAAAAGAGCCGAATGGTGAATTTAGTTCGATTGACGTGGTTGGCTGGCTTCTTGAACAGACGTGCCGCGCAAAC
GAGCAACTACAAGGACTATTTATTGCACAAGGGCTCAATTTTTGCCGTCGACAAAACGCAATATTAGAAAACCCT
CTCTTTTTGAGCAGTCCGAGCCAGCGATCTGCAGTTTTGAACATTGTAAGGTCTACGGAGCATCTCACGCTAGAT
GAGCTCTACGGCAACCAAGGCGGGCGCCAAAATCACGAACCAGTACATGGAGTTAATAGTAGCCTGCAAGGGCTC
GTTGAGCAACTGGATAAGCAAAAGCAAGTCTTTGTGCACGGCGAGTCGTCCATGGTGGCGAATGCAATGGACGAA
GTTGAACAAGAGCGAGAAGTGGAGTTTCAGGTTGAAGAGGTGCGCGAGGTGCAAAAGCCGAAACATCGAAAAGCA
CTCTCCTTTCCGGGCCTGCACCAGAGCGTTGCGGCCTTTATACAAACGGGGGTGCTCTCGGCTGGAGATGGATGC
CAGGAGATGAGTGTTTTCTTGGCGCAAACGGCGTTGGGAAAGCAGCACGAGCTTGAAATGTCGGGGTCGAGGCTG
CTCGTCTCGGAGCAGTTTTTGCGCACAGTTGAAACGGGGACAAATCGTCCCATTGACGATAACTATGCCAGACCA
GTCGAGTGGGTTTTATGGAGTCCTGGGACTGGAGTTGCTCTGGTTGTGATTCCTGAAGAGGCAGAAATCGCCATG
CCCCTGATTCGCGCCATGCCGACTCCCATGGTGCATCTCATGACCTATTCTGCTCCCGTCACGAGACATATGCTG
CGATTCGGGCAGCTCGAGTATTACGCCCTTCCCAGTCTCTCGACCAATGATGCGACGCCCCCGTGGCTAAGCATT
GAGCTTGGAATCGTGGGTGCTCGCCTCTACTTTAGTCATGACGAGTACGAGGCATTGCTCAAGCATCTAAAAGCG
TTGGATGGTCAGAGCAGCCAGCAGACGGCAAAGGGAAAGCTCCTTGGGTTTGTTTTTGAATGGCTGACGGTGAGG
CGCAAAGGACAAGACATTTTGCATACGCCCATGGGATATGTTTGCCAGGGGCGGGCGCTGGGACAAGGCCATGCC
TTTTTTGGCGGTGGCGCCGAAGCGGCAGCGCGTCTAGAGGTGAGAAGCGCGACGGCGTCGGAAACGGGACACGAG
GATCCGAGGGTTTCCGAGGTGGAGGAGGCGACGCAGTCTGAAGAGGACAATGACTCTTTGGAGGAGTAG
Transcript >OphauG2|1096
ATGGATTGGATCTTTCCGGGGAGTGCCGTTGAGGTCCCTTTTACCACTTTTCGAGACGAATCATTCACCAATAAC
CTGGCTCTTTTTATACAAAAGGCCTCCGAGGAGACTCTTTCGCGTTTCTCAGCGCGCGCGATTAAGTCCGGATCG
TCCATTATAGAGAATCGTGATCCTCCTCACCCAGGACTCATCTCCCAGTTCCTTATGGCCTTGCTCGGTGCAGTC
GGGAACTTTGTCGAGGTTCCCGAGCTAAGAAAACGTGTGAGGGATGATATCAATTTTGGAAAAGGCGAAATGCCA
TGGCGACGTTGTCCATCGTGGCTAGTGTTGCGAGTGGCTATGCAACGCCAACTCGGTCTCGTCCTGGGCCAGGAC
TTGGGGCGTGCCGCGTACAAGCTCGTCATTTGCGCCATACTCGAGCAATTGCTCGATGCTTGTGCAGGTGTTTTG
TCGCCTGAGCTAACCATCATGTTAAAAGCCAAACTTTGTCGTCGACTTGCCAAATTGGAGCGACTAAGAGAGCAG
TCGCCAGAGCTCTTGTCGTCCTTTTTAGAACAAGCCTTTTCTGCCGTCGCAACCAAGTCTCAAAGGACGGTTGAA
AAAGCCACAAACCAGGTTGAGACAGCGTGGAAGCAGTACAAAGTGTCGATTACGCGCACCATTCCCCACTTACCC
TGCCGAGCAAATGATGACGCGCTGCGGTTGAGCCTTCACAATAGCCAACATCATTTACAACAGCTTTTGAAGCAG
CCGTTCAAGAACACAAGACATGCTCCTTGCGAAAACCCATACGTCAAGGACGATACAGAGGATCAGATGAGAAAT
CTGGCCAAGTTTTCAAGTCAGCTTGAGACGCTGGAAGCTCGTCTTCACATGCAAATCTTGGATGATGAATTTCCC
GAGAGCCAGCAAAAACTCGAGTTGCGCTGCATATCTTTTTGTGACAGCATTTACGACCTCTTTACACTAGTTGAT
GACGCCTTTCTAGGAAAGCCAGATCAGATGAGCCTTTTAATTCTGAGATTACTCGAACTATGGGTCCAACTAGAC
AAAAGTGCATGCAAAATATGTCCTTTACTTTTCGACTACTCTATATTATTTCGGCCCGAAGCTCTCGATGTACTT
CATCTTGCCCGCATCTCGGAGATGCAGAGACTTCAGACGGTACAACTTTATCTTAGCGAAAGACAACAACGGTGT
GGAGCTTCAGCAAACTCTATCTACAGTGAACCAAGTCTTGGCTCTTTTGCGGTACGCTATCTGGACGAGTCAGAA
GACGGCCCGAGACTATGCACTCTGCTCGATAGAATTTCAGCCGCATCGCAACGCGCGCAAAACTCCAAAGACGCA
GAGTGGAAGCAGTTATGCCGAGAATATGATAGTCTCACCGACAAGATTGCTAGCGCTACTTGCCTCTGCACTATT
CAACAAGACGGCCAGCGAGATGTCCGAGGATGTAACAAGTGCTGGTACTGGCGCTGTCGGAAACGCATGACTATC
AGCGCCCACGAAGACTATCTCCCTCAAGGAAGACCTGAAAAAGCCGCCGTTGTCTTTGAGCTTGGAATCCCAAAG
TACCTGCAGCAATATCGCAACGCCACATGGCGGATATTTCGGAAACTAGGGTATCCAGGAGCCAAAACGGACGCT
TCAAATGCCATAATGCTGCTGAAAGACTATGAGCAGTTAAAGGAATACAAAGCAGCCACCTGTAATGGAATATCT
CTGGCATCCTCGGTCAAGTCGTTTTTGCAGACACATTACGCCAGGGTGAAGATGAAGGCTGATGCAGCAAGTGTT
TTCCTGCCTCATGGCCCGGTTTTTCATTACTACGATCAAACCAATCGTGAATGGCTAAAAGACCTTTCAGCTCCC
GCCTCCTTCCAACACCACTGTGGTTTCAGTCTCCCACGAGCTTTACTAGACGCATCCATTAGAAATCCACGGCAT
CCTGCGTGGAATGATGGACCTTCTTCGTACGAGACAGTGGCCAGTCTAACAAAATGTCCCCGAGGCATGTCGAGC
CATGAGTTCATGGCCGTGCAGCGACTGATTGGAGGCAAGAACCGACGTTGGTTGACGATGCTTGTCGAGCTCGGT
TCTTCAAACATCAACATGAGCGATGAAGAGAGCCTTTGTTTGATGACTGAGCTCGCTGTACAGGCTGGTCCTCTG
GCGGAGACGAGCGACGTTTTGCGGGATGTGCATGTCGTGTTTCGTGACGACGAGTTTTGTCAGCGACTCTCGGAG
CAAATTAACAAGCGCCTTGGCATGATCAAAGCAAACTGGCGGGAAACCCACTGCATGGACTTTATGGTGACGCTT
GCCCTACGTCTTCACAGTCTTGGAGGCGCCAGTGCTCGACTAGAAGCCGAAAAGGCGCTTCAAACTGCGCGTGAG
ACAATTTTAACCTGGGTCATGAGCTTACGCACCAATTGCAGAACGGAGCAGAATGCCGAAGCTGCCAAGCGTCTT
TCCCGATATGCCTTTCGAGCAGCCATGATATGCCGACGCACATTTGCAATTTTTGAGAATACTGACAGGCTAATG
AGTGGAGATGAGTTGAGCTGTTTTATAATAGCCTCTGTTGCTCTACAGCAAAACTTGATGGACATCTCGGCACTT
GAGCCAAAAATGCATGGCTTTTTGATGAATGATTTAAGACTGGCTTTTCGGCTCCGCTCAGTCATTGACAAATCA
GCCCGAGGATACCCAAGACACTTGGGTGAAGCAATTTTAAAGTCTATTCGTGGAGACCTGAACACAACTATTGCA
GAGCGCTTCTCTCAATGGGTGTTTCCAGCAGCGTTGGATCACTACTGGGTTGCCTTTGACATGTGCTGCTTGGAG
CGAGAGGGAGAAGGAGCACAAACAGTACAGTACCATTTACTTGAAGGTCATCTCAAGATCAACGGACAGACACTG
GGGAGGCTTCCAGTGGAAATTATGAACTCCAATAGTGTCAAGGAGCTGTTCGGCGACCAGAATTTGACAACATTT
CCCTCCATTTATGGCGACTTGAGCCACGTTTTGGCTGACAAGTTGCATGGCTACGAGGTTCATCTAGGAATGCGC
GACGGTGAAGTTGTTATCCGAGCCCGCAAACGATTTGGTACTTTTGAGTATATACCCGCAAAGTACTTCTACGGC
TCGGGGAGAAACAATTTTGACCTGCCCGAGGAGCTTGTCGTTGACTGCGCTCACTGGCTTAACCTTGATACTGGA
ATACTTGAAATCCGTCGCAAGCCTTTAATCTGGGTTGATCGGCCAGGCAACTGGAAAATCAATCTCCACAACGGT
AAAGCCTTTCGTCGAGAGTCCAAACTCGTGGACCCAAGATCAGTGCTCTGCCAACAGATTTATGCAATATACTCG
GGCTTTGAGCAGCCTCAGCGACTTACTGTTTTCCAGCCTAGAATGGGCAGCCTATCAGTCTTTTTGCATCGACTT
AAGCTTACATTTAATGTCAACGGAAAGAATCTGCTTGAATGTAGAGAGCTGAAATGTGAGATTGACCCCAACCAG
GATGCGGGAACACTGTACGGGCTACAGAGCAAGCTGGTTCTCCGCGATAGCGACAACACTGGAAGACGAAGCATT
CTTGCTGGGCTGGGGCATCTCGTATATCAGCGTAGAGGCATGCACGTTGCTGTGGGGACCCGAGACATCACGGCG
TATGCTCGATATGAAATCGATGCCGTTCTGGGGCGTCTGTCATGTCCACCCGAGCCGCGCCTTCTCTACTCCAAG
GCCTTGTTCCATGCCCTGACATCTTTTGTCTTGTCAGACCCCTTGACTGGCTCTACGGGCACCGAGGAGGCATAT
CGCATTTTGAGCTCTGGCTACTGTCAGCCGTGGAAGCCGCTGCACCCAGGAACCATTGAGCACATTCTGAAAGAA
ATCCAGGGGTTAAGTCCTGCCAGAGAGTATTATCCGCCAGACAAGAGACAGCTCCAGTGCGTGTCGTGGAACCCA
GATCTCACAGTCACAATCCAGCACGATTGCTACCATAGACTTGTTGAAGATATTCTCAAAAAGTCGCAGCGCCTA
GAGGTTTTTAATGGCATAAAGTATGCTAGACAACCAAATGGGGACACTGCAACAAATACACACCTCAGAGACCGA
GCCGAGATACGACGATCGCTTTTGGAGCGCAGCATTTCAGAGACTTGGATTATGCCACACCAATCTCGCACAGTA
TATAAATCCAGAGACAGGCTTGCCATGGCCTCAACCGATTCAAACGTATACAAGACTGTCGCTTTGTTACGACAA
GAAACATTCTCGGGTTGTCTTGACATTAGACTTGCAAGCATGCTCGAACAATTCCCAAACCAGCTTATAGGAGGG
TTTGCTACCACGTCGCAATTTGCTTCTCAATCTCTCGACCAGCTTATTGACGGCAGCATTGGTGAACAATGGGGT
AGCTTGGTCAATTACTGCTGCGCCTCAAAAGCAAAGGGTAAATTCAATGCTATATTTCGACTGGGTCTACTCTCT
TTTGGCCTGAACGCGAACCGCGACGCAATAACATTTCTCTGTGCGTTTTCCATTATAGAGGAACTATGGGATATT
GCTCCGCCTGTCGGCGATGTTTTCCGGAGCTTTAAATTTGAGGAACGGCCTAGCATTGAATATCTCGAGGCACTC
ATTCAAAGAACTCTAAGCAAAACAGAACCAGGCGTCAAGCGCAAAAAGTTGGACAATGGCTCTGCCTCTCCGGAG
AGTAAAGAAAATCCAAGCAAGAGGCTAATACTAGCTGAGTATTTGGCGAAACAATGGCCAAGTGCCCAGCTATTA
TACGCGGGGCTAGATTCACTTGAGCTAGAGTCACTAGATATCGACAAGATCCAGGAGGCGGTTGAGCCCGAGTGG
CGTCGGCTTATAGACAATGAGCTCCTCTCGAGGTATATTGTTGAGGTTCAGTCGGTAATAGATCGCTATTCCTGC
CAGCAAGGGCCCGATATTTCAATACCTCGAAACTTGAGGTTGGTTCTCGAGGACACGGCGTTCAGGATTCCGACA
GATTTAGTTCCTTCCTTGGCGAAAGAACTCTTGGTCAAACAGGCGCCAAAGATGCCAGAGCTTGCTTGCCTTGGC
CAAAGACTACAAGAGGCTACAGTTGACCGGTTCCTGGAAGACCATGACGGCAACTCTCGAGAAATGTTCAAGCAG
GAAAACCACGTCATGAGTGAGGTCAAAGGGCTGCTTGAGCGCTTTATTCAATCGCCGAAGCCACTTTGGCAACAG
TACGGCAACGATTTGCTCGAAAGTTATTACGCGCTGCAATATAGGAGAAGCAGCAAAGAAAAAGTATCAAATCCA
CCAAGTCTTGCCGAGATTGATGAAAGGATCAATGTGGCTGAAAGGTCGCTGGTGATGTGTCTCGAGGTCCTTCGT
GGAGCCTTGTCAGCAAACAATGGGGTCTGCAAGTGGCTCAACATGGGCAACATGTGGCCGCGAGTGACTCCAGTG
ACTGTACTGCAACTGCTGCGCACGCGGGACAAGAACATTTTTGGTCCAGGCATGAAGGAGCTTCTGGTTGCCTAT
GGGACTTTGATTGCGACTCTGCAGTGGCTGTTGCGGATTAAGCGCGAGTACATGAGAGGAGATGAACAGAAGCTT
CTGGAGCAGTGGAATGATCGGGGCCACGGCAACTGGGACCCCTTTGAGTACCCGGACTGGCTTTTGTTGGAGATT
GAAAGCAACATTTTTATTCGGCCCGAGCAGGTCGAGGTGGCGCATGCCATTATACGGCCGCCATCATCAGCCAAT
TCGCTTCTCCAGCTGAATATGGGCAAAGGCAAAACTTCGTGTATTGTCCCTATGGTTGTCTTGGTATTGGCTGAC
TCTGAAAGGCTCTGTCGGCTCATTGTGCCCAAGGCTTTAACACAGCAAGCAGCTCAGATCCTGCAGTGCCGCATC
GGGGGCCTCTTGGGGCGCGAGATTCGACAGATTCCCTTTTCTCGTCGCACGCCGACATCGAGCGACGTGCAGCAA
GCATACCTTGATTTACACTGCCAAGTCCGCGACTTGAGTGGAGTCATTCTCGCTATACCAGAACACATTCTCTCA
TACAAGCTCAGCGGATTTCAGAGGCTGGCTGATGGGAATGTCAAGGAAGCGCATGCCATGTTTGAGGGCCAAGAA
TGGCTCGACTCGACGTGCCGTGATGTGCTGGATGAATCAGACTTTACGCTGGCTGTCAAGACGCAGCTCATTTAT
CCCAGTGGAGAGTTGGTGCCGGTTGATGGCCACCCCGACCGCTGGATCTTGGCACAGTCTCTGCTTAGTCTGGTA
GAGGAAAGACTTGAAGACCTTTGCAGCAGCTTTCCGCACGGCATACAGGTTCTCAAACGAAGGCCAGGGTTTCCC
ATGATTTACATTACCCATTCAGATGTGGAAAAAGCCTTACGAGACAGCTTGACCGAGGCAATCATTCAGGGCAGG
ACTTCATTTCTGCCAGTCTCCATGAGTCTTTCCAATACATCAATAAAGATGTTGCGGAAGCTGCTTGTGGAAGAC
GCTCCGGAAAGACAAACGTTTGAGCGTGTCAAGAGAGCACTTGCGGCCAAGCCATCCGTCTACAAGGGGCTCTTG
CTCGCCCGCGGCCTGCTGCTACAAGGAATTCTCTTCCTCTGCCTACGCAAGCGATGGAATGTCCAGTATGGCTTA
CATGCAGATCGCGATCCTATTGCGGTTCCTTATGAAGCCAAAGGCGTGCCTTCAGCGCAAGCCGAGTTTGGCCAC
CCTGATGTGGCGATACTGCTCACTTGCCTGGCCTTCTACTACTCTGGTCTGACAGTTGGCCAGTTGCGCGACGGA
TTGGGACATGTTCTCAAGTCGGATGACCCAGGGGCCGAATACGACAGATGGACTGCGGGTTGTGCCACGTTGCCG
CCAGGTCTCCGCCAGTGGAATCTCGTCAATGTGGATGACTCTGGACAGGTTGAAGAACTGTGGCACCATTTGCGC
TTGAACAAGAGTGTCTTGGACCACTTCATGAATCACTTTGTCTTTCCACGTCATGCGAAGCAGTTCAACATTAAG
CTGCAGTCGTCAGGCTGGGACTTGCCACTATCTTGGTTCAATGGCTCAAATCCCTTGGCGAGGACGACGGGCTTT
AGCGGAACAAATGACAATCGACGGCTGCTCCCGCTGCTCATCCAGCAGCATGACTTGGTCTCCTTAAAGCACACC
AGCGCCGAGGTGCTCACGTATTTGTTGGAAGAACGAAACCGACAGTATACCGTTGCCAAGGATGCTCAAGGCGCA
CGCCTTTCTGAGACGGAACTGCTCAGAACATTACATGGCAAACAGATTCGGGTTCTCATTGATGCAGGGGCATAT
ATCCTCGAAATGGACAATAGGAGCCTTGTTCAAACGTGGTTACAGATTGACCACGAGGCCAAAGCAGGCGTCTAT
TTGGGAGCCGACGATAATAGGGCTTGGGTGCAGTATAGCAACGGCAAAGATGCGGTTCCTCTTTTGGCCACGCCC
TATGCGGAAAACCTCGACGGGTGTCTAGTCTACTTGGACGAGGCTCATACCCGTGGTACCGACCTACAGCTGCCC
AAGACGACACATGGAGCGCTTACTCTTGCTCTGGGACAAACCAAGGATCATACTGTTCAAGCCGCCATGAGACTG
CGAAAGCTAGCAACAACCCAGTCGATAAGCTTTTGGGCGCCACCAGAGGTTCATCAGAGCATTGTCGAATCGTCA
GGAAAAGAGCCGAATGGTGAATTTAGTTCGATTGACGTGGTTGGCTGGCTTCTTGAACAGACGTGCCGCGCAAAC
GAGCAACTACAAGGACTATTTATTGCACAAGGGCTCAATTTTTGCCGTCGACAAAACGCAATATTAGAAAACCCT
CTCTTTTTGAGCAGTCCGAGCCAGCGATCTGCAGTTTTGAACATTGTAAGGTCTACGGAGCATCTCACGCTAGAT
GAGCTCTACGGCAACCAAGGCGGGCGCCAAAATCACGAACCAGTACATGGAGTTAATAGTAGCCTGCAAGGGCTC
GTTGAGCAACTGGATAAGCAAAAGCAAGTCTTTGTGCACGGCGAGTCGTCCATGGTGGCGAATGCAATGGACGAA
GTTGAACAAGAGCGAGAAGTGGAGTTTCAGGTTGAAGAGGTGCGCGAGGTGCAAAAGCCGAAACATCGAAAAGCA
CTCTCCTTTCCGGGCCTGCACCAGAGCGTTGCGGCCTTTATACAAACGGGGGTGCTCTCGGCTGGAGATGGATGC
CAGGAGATGAGTGTTTTCTTGGCGCAAACGGCGTTGGGAAAGCAGCACGAGCTTGAAATGTCGGGGTCGAGGCTG
CTCGTCTCGGAGCAGTTTTTGCGCACAGTTGAAACGGGGACAAATCGTCCCATTGACGATAACTATGCCAGACCA
GTCGAGTGGGTTTTATGGAGTCCTGGGACTGGAGTTGCTCTGGTTGTGATTCCTGAAGAGGCAGAAATCGCCATG
CCCCTGATTCGCGCCATGCCGACTCCCATGGTGCATCTCATGACCTATTCTGCTCCCGTCACGAGACATATGCTG
CGATTCGGGCAGCTCGAGTATTACGCCCTTCCCAGTCTCTCGACCAATGATGCGACGCCCCCGTGGCTAAGCATT
GAGCTTGGAATCGTGGGTGCTCGCCTCTACTTTAGTCATGACGAGTACGAGGCATTGCTCAAGCATCTAAAAGCG
TTGGATGGTCAGAGCAGCCAGCAGACGGCAAAGGGAAAGCTCCTTGGGTTTGTTTTTGAATGGCTGACGGTGAGG
CGCAAAGGACAAGACATTTTGCATACGCCCATGGGATATGTTTGCCAGGGGCGGGCGCTGGGACAAGGCCATGCC
TTTTTTGGCGGTGGCGCCGAAGCGGCAGCGCGTCTAGAGGTGAGAAGCGCGACGGCGTCGGAAACGGGACACGAG
GATCCGAGGGTTTCCGAGGTGGAGGAGGCGACGCAGTCTGAAGAGGACAATGACTCTTTGGAGGAGTAG
Gene >OphauG2|1096
ATGGATTGGATCTTTCCGGGGAGTGCCGTTGAGGTCCCTTTTACCACTTTTCGAGACGAATCATTCACCAATAAC
CTGGCTCTTTTTATACAAAAGGCCTCCGAGGAGACTCTTTCGCGTTTCTCAGCGCGCGCGATTAAGTCCGGATCG
TCCATTATAGAGAATCGTGATCCTCCTCACCCAGGACTCATCTCCCAGTTCCTTATGGCCTTGCTCGGTGCAGTC
GGGAACTTTGTCGAGGTTCCCGAGCTAAGAAAACGTGTGAGGGATGATATCAATTTTGGAAAAGGCGAAATGCCA
TGGCGACGTTGTCCATCGTGGCTAGTGTTGCGAGTGGCTATGCAACGCCAACTCGGTCTCGTCCTGGGCCAGGAC
TTGGGGCGTGCCGCGTACAAGCTCGTCATTTGCGCCATACTCGAGCAATTGCTCGATGCTTGTGCAGGTGTTTTG
TCGCCTGAGCTAACCATCATGTTAAAAGCCAAACTTTGTCGTCGACTTGCCAAATTGGAGCGACTAAGAGAGCAG
TCGCCAGAGCTCTTGTCGTCCTTTTTAGAACAAGCCTTTTCTGCCGTCGCAACCAAGTCTCAAAGGACGGTTGAA
AAAGCCACAAACCAGGTTGAGACAGCGTGGAAGCAGTACAAAGTGTCGATTACGCGCACCATTCCCCACTTACCC
TGCCGAGCAAATGATGACGCGCTGCGGTTGAGCCTTCACAATAGCCAACATCATTTACAACAGCTTTTGAAGCAG
CCGTTCAAGAACACAAGACATGCTCCTTGCGAAAACCCATACGTCAAGGACGATACAGAGGATCAGATGAGAAAT
CTGGCCAAGTTTTCAAGTCAGCTTGAGACGCTGGAAGCTCGTCTTCACATGCAAATCTTGGATGATGAATTTCCC
GAGAGCCAGCAAAAACTCGAGTTGCGCTGCATATCTTTTTGTGACAGCATTTACGACCTCTTTACACTAGTTGAT
GACGCCTTTCTAGGAAAGCCAGATCAGATGAGCCTTTTAATTCTGAGATTACTCGAACTATGGGTCCAACTAGAC
AAAAGTGCATGCAAAATATGTCCTTTACTTTTCGACTACTCTATATTATTTCGGCCCGAAGCTCTCGATGTACTT
CATCTTGCCCGCATCTCGGAGATGCAGAGACTTCAGACGGTACAACTTTATCTTAGCGAAAGACAACAACGGTGT
GGAGCTTCAGCAAACTCTATCTACAGTGAACCAAGTCTTGGCTCTTTTGCGGTACGCTATCTGGACGAGTCAGAA
GACGGCCCGAGACTATGCACTCTGCTCGATAGAATTTCAGCCGCATCGCAACGCGCGCAAAACTCCAAAGACGCA
GAGTGGAAGCAGTTATGCCGAGAATATGATAGTCTCACCGACAAGATTGCTAGCGCTACTTGCCTCTGCACTATT
CAACAAGACGGCCAGCGAGATGTCCGAGGATGTAACAAGTGCTGGTACTGGCGCTGTCGGAAACGCATGACTATC
AGCGCCCACGAAGACTATCTCCCTCAAGGAAGACCTGAAAAAGCCGCCGTTGTCTTTGAGCTTGGAATCCCAAAG
TACCTGCAGCAATATCGCAACGCCACATGGCGGATATTTCGGAAACTAGGGTATCCAGGAGCCAAAACGGACGCT
TCAAATGCCATAATGCTGCTGAAAGACTATGAGCAGTTAAAGGAATACAAAGCAGCCACCTGTAATGGAATATCT
CTGGCATCCTCGGTCAAGTCGTTTTTGCAGACACATTACGCCAGGGTGAAGATGAAGGCTGATGCAGCAAGTGTT
TTCCTGCCTCATGGCCCGGTTTTTCATTACTACGATCAAACCAATCGTGAATGGCTAAAAGACCTTTCAGCTCCC
GCCTCCTTCCAACACCACTGTGGTTTCAGTCTCCCACGAGCTTTACTAGACGCATCCATTAGAAATCCACGGCAT
CCTGCGTGGAATGATGGACCTTCTTCGTACGAGACAGTGGCCAGTCTAACAAAATGTCCCCGAGGCATGTCGAGC
CATGAGTTCATGGCCGTGCAGCGACTGATTGGAGGCAAGAACCGACGTTGGTTGACGATGCTTGTCGAGCTCGGT
TCTTCAAACATCAACATGAGCGATGAAGAGAGCCTTTGTTTGATGACTGAGCTCGCTGTACAGGCTGGTCCTCTG
GCGGAGACGAGCGACGTTTTGCGGGATGTGCATGTCGTGTTTCGTGACGACGAGTTTTGTCAGCGACTCTCGGAG
CAAATTAACAAGCGCCTTGGCATGATCAAAGCAAACTGGCGGGAAACCCACTGCATGGACTTTATGGTGACGCTT
GCCCTACGTCTTCACAGTCTTGGAGGCGCCAGTGCTCGACTAGAAGCCGAAAAGGCGCTTCAAACTGCGCGTGAG
ACAATTTTAACCTGGGTCATGAGCTTACGCACCAATTGCAGAACGGAGCAGAATGCCGAAGCTGCCAAGCGTCTT
TCCCGATATGCCTTTCGAGCAGCCATGATATGCCGACGCACATTTGCAATTTTTGAGAATACTGACAGGCTAATG
AGTGGAGATGAGTTGAGCTGTTTTATAATAGCCTCTGTTGCTCTACAGCAAAACTTGATGGACATCTCGGCACTT
GAGCCAAAAATGCATGGCTTTTTGATGAATGATTTAAGACTGGCTTTTCGGCTCCGCTCAGTCATTGACAAATCA
GCCCGAGGATACCCAAGACACTTGGGTGAAGCAATTTTAAAGTCTATTCGTGGAGACCTGAACACAACTATTGCA
GAGCGCTTCTCTCAATGGGTGTTTCCAGCAGCGTTGGATCACTACTGGGTTGCCTTTGACATGTGCTGCTTGGAG
CGAGAGGGAGAAGGAGCACAAACAGTACAGTACCATTTACTTGAAGGTCATCTCAAGATCAACGGACAGACACTG
GGGAGGCTTCCAGTGGAAATTATGAACTCCAATAGTGTCAAGGAGCTGTTCGGCGACCAGAATTTGACAACATTT
CCCTCCATTTATGGCGACTTGAGCCACGTTTTGGCTGACAAGTTGCATGGCTACGAGGTTCATCTAGGAATGCGC
GACGGTGAAGTTGTTATCCGAGCCCGCAAACGATTTGGTACTTTTGAGTATATACCCGCAAAGTACTTCTACGGC
TCGGGGAGAAACAATTTTGACCTGCCCGAGGAGCTTGTCGTTGACTGCGCTCACTGGCTTAACCTTGATACTGGA
ATACTTGAAATCCGTCGCAAGCCTTTAATCTGGGTTGATCGGCCAGGCAACTGGAAAATCAATCTCCACAACGGT
AAAGCCTTTCGTCGAGAGTCCAAACTCGTGGACCCAAGATCAGTGCTCTGCCAACAGATTTATGCAATATACTCG
GGCTTTGAGCAGCCTCAGCGACTTACTGTTTTCCAGCCTAGAATGGGCAGCCTATCAGTCTTTTTGCATCGACTT
AAGCTTACATTTAATGTCAACGGAAAGAATCTGCTTGAATGTAGAGAGCTGAAATGTGAGATTGACCCCAACCAG
GATGCGGGAACACTGTACGGGCTACAGAGCAAGCTGGTTCTCCGCGATAGCGACAACACTGGAAGACGAAGCATT
CTTGCTGGGCTGGGGCATCTCGTATATCAGCGTAGAGGCATGCACGTTGCTGTGGGGACCCGAGACATCACGGCG
TATGCTCGATATGAAATCGATGCCGTTCTGGGGCGTCTGTCATGTCCACCCGAGCCGCGCCTTCTCTACTCCAAG
GCCTTGTTCCATGCCCTGACATCTTTTGTCTTGTCAGACCCCTTGACTGGCTCTACGGGCACCGAGGAGGCATAT
CGCATTTTGAGCTCTGGCTACTGTCAGCCGTGGAAGCCGCTGCACCCAGGAACCATTGAGCACATTCTGAAAGAA
ATCCAGGGGTTAAGTCCTGCCAGAGAGTATTATCCGCCAGACAAGAGACAGCTCCAGTGCGTGTCGTGGAACCCA
GATCTCACAGTCACAATCCAGCACGATTGCTACCATAGACTTGTTGAAGATATTCTCAAAAAGTCGCAGCGCCTA
GAGGTTTTTAATGGCATAAAGTATGCTAGACAACCAAATGGGGACACTGCAACAAATACACACCTCAGAGACCGA
GCCGAGATACGACGATCGCTTTTGGAGCGCAGCATTTCAGAGACTTGGATTATGCCACACCAATCTCGCACAGTA
TATAAATCCAGAGACAGGCTTGCCATGGCCTCAACCGATTCAAACGTATACAAGACTGTCGCTTTGTTACGACAA
GAAACATTCTCGGGTTGTCTTGACATTAGACTTGCAAGCATGCTCGAACAATTCCCAAACCAGCTTATAGGAGGG
TTTGCTACCACGTCGCAATTTGCTTCTCAATCTCTCGACCAGCTTATTGACGGCAGCATTGGTGAACAATGGGGT
AGCTTGGTCAATTACTGCTGCGCCTCAAAAGCAAAGGGTAAATTCAATGCTATATTTCGACTGGGTCTACTCTCT
TTTGGCCTGAACGCGAACCGCGACGCAATAACATTTCTCTGTGCGTTTTCCATTATAGAGGAACTATGGGATATT
GCTCCGCCTGTCGGCGATGTTTTCCGGAGCTTTAAATTTGAGGAACGGCCTAGCATTGAATATCTCGAGGCACTC
ATTCAAAGAACTCTAAGCAAAACAGAACCAGGCGTCAAGCGCAAAAAGTTGGACAATGGCTCTGCCTCTCCGGAG
AGTAAAGAAAATCCAAGCAAGAGGCTAATACTAGCTGAGTATTTGGCGAAACAATGGCCAAGTGCCCAGCTATTA
TACGCGGGGCTAGATTCACTTGAGCTAGAGTCACTAGATATCGACAAGATCCAGGAGGCGGTTGAGCCCGAGTGG
CGTCGGCTTATAGACAATGAGCTCCTCTCGAGGTATATTGTTGAGGTTCAGTCGGTAATAGATCGCTATTCCTGC
CAGCAAGGGCCCGATATTTCAATACCTCGAAACTTGAGGTTGGTTCTCGAGGACACGGCGTTCAGGATTCCGACA
GATTTAGTTCCTTCCTTGGCGAAAGAACTCTTGGTCAAACAGGCGCCAAAGATGCCAGAGCTTGCTTGCCTTGGC
CAAAGACTACAAGAGGCTACAGTTGACCGGTTCCTGGAAGACCATGACGGCAACTCTCGAGAAATGTTCAAGCAG
GAAAACCACGTCATGAGTGAGGTCAAAGGGCTGCTTGAGCGCTTTATTCAATCGCCGAAGCCACTTTGGCAACAG
TACGGCAACGATTTGCTCGAAAGTTATTACGCGCTGCAATATAGGAGAAGCAGCAAAGAAAAAGTATCAAATCCA
CCAAGTCTTGCCGAGATTGATGAAAGGATCAATGTGGCTGAAAGGTCGCTGGTGATGTGTCTCGAGGTCCTTCGT
GGAGCCTTGTCAGCAAACAATGGGGTCTGCAAGTGGCTCAACATGGGCAACATGTGGCCGCGAGTGACTCCAGTG
ACTGTACTGCAACTGCTGCGCACGCGGGACAAGAACATTTTTGGTCCAGGCATGAAGGAGCTTCTGGTTGCCTAT
GGGACTTTGATTGCGACTCTGCAGTGGCTGTTGCGGATTAAGCGCGAGTACATGAGAGGAGATGAACAGAAGCTT
CTGGAGCAGTGGAATGATCGGGGCCACGGCAACTGGGACCCCTTTGAGTACCCGGACTGGCTTTTGTTGGAGATT
GAAAGCAACATTTTTATTCGGCCCGAGCAGGTCGAGGTGGCGCATGCCATTATACGGCCGCCATCATCAGCCAAT
TCGCTTCTCCAGCTGAATATGGGCAAAGGTTGGTTGTGCAAGGCTTTTCTTTTGTCTAAAAAAAAGCCATAATGT
CACGTCTTTTACATAGGGTAGTGTGCTGATTATTATTCTTGTCTAGGCAAAACTTCGTGTATTGTCCCTATGGTT
GTCTTGGTATTGGCTGACTCTGAAAGGCTCTGTCGGCTCATTGTGCCCAAGGCTTTAACACAGCAAGCAGCTCAG
ATCCTGCAGTGCCGCATCGGGGGCCTCTTGGGGCGCGAGATTCGACAGATTCCCTTTTCTCGTCGCACGCCGACA
TCGAGCGACGTGCAGCAAGCATACCTTGATTTACACTGCCAAGTCCGCGACTTGAGTGGAGTCATTCTCGCTATA
CCAGAACACATTCTCTCATACAAGCTCAGCGGATTTCAGAGGCTGGCTGATGGGAATGTCAAGGAAGCGCATGCC
ATGTTTGAGGGCCAAGAATGGCTCGACTCGACGTGCCGTGATGTGCTGGATGAATCAGACTTTACGCTGGCTGTC
AAGACGCAGCTCATTTATCCCAGTGGAGAGTTGGTGCCGGTTGATGGCCACCCCGACCGCTGGATCTTGGCACAG
TCTCTGCTTAGTCTGGTAGAGGAAAGACTTGAAGACCTTTGCAGCAGCTTTCCGCACGGCATACAGGTTCTCAAA
CGAAGGCCAGGGTTTCCCATGATTTACATTACCCATTCAGATGTGGAAAAAGCCTTACGAGACAGCTTGACCGAG
GCAATCATTCAGGGCAGGACTTCATTTCTGCCAGTCTCCATGAGTCTTTCCAATACATCAATAAAGATGTTGCGG
AAGCTGCTTGTGGAAGACGCTCCGGAAAGACAAACGTTTGAGCGTGTCAAGAGAGCACTTGCGGCCAAGCCATCC
GTCTACAAGGGGCTCTTGCTCGCCCGCGGCCTGCTGCTACAAGGAATTCTCTTCCTCTGCCTACGCAAGCGATGG
AATGTCCAGTATGGCTTACATGCAGATCGCGATCCTATTGCGGTTCCTTATGAAGCCAAAGGCGTGCCTTCAGCG
CAAGCCGAGTTTGGCCACCCTGATGTGGCGATACTGCTCACTTGCCTGGCCTTCTACTACTCTGGTCTGACAGTT
GGCCAGTTGCGCGACGGATTGGGACATGTTCTCAAGTCGGATGACCCAGGGGCCGAATACGACAGATGGACTGCG
GGTTGTGCCACGTTGCCGCCAGGTCTCCGCCAGTGGAATCTCGTCAATGTGGATGACTCTGGACAGGTTGAAGAA
CTGTGGCACCATTTGCGCTTGAACAAGAGTGTCTTGGACCACTTCATGAATCACTTTGTCTTTCCACGTCATGCG
AAGCAGTTCAACATTAAGCTGCAGTCGTCAGGCTGGGACTTGCCACTATCTTGGTTCAATGGCTCAAATCCCTTG
GCGAGGACGACGGGCTTTAGCGGAACAAATGACAATCGACGGCTGCTCCCGCTGCTCATCCAGCAGCATGACTTG
GTCTCCTTAAAGCACACCAGCGCCGAGGTGCTCACGTATTTGTTGGAAGAACGAAACCGACAGTATACCGTTGCC
AAGGATGCTCAAGGCGCACGCCTTTCTGAGACGGAACTGCTCAGAACATTACATGGCAAACAGATTCGGGTTCTC
ATTGATGCAGGGGCATATATCCTCGAAATGGACAATAGGAGCCTTGTTCAAACGTGGTTACAGATTGACCACGAG
GCCAAAGCAGGCGTCTATTTGGGAGCCGACGATAATAGGGCTTGGGTGCAGTATAGCAACGGCAAAGATGCGGTT
CCTCTTTTGGCCACGCCCTATGCGGAAAACCTCGACGGGTGTCTAGTCTACTTGGACGAGGCTCATACCCGTGGT
ACCGACCTACAGCTGCCCAAGACGACACATGGAGCGCTTACTCTTGCTCTGGGACAAACCAAGGATCATACTGTT
CAAGGTGAGTTGACAAGGGATATTTTTCATTGCGTCGTTGATGTGGAAGCTTACCATCCCCCTCTTGCTTTTTTT
AGCCGCCATGAGACTGCGAAAGCTAGCAACAACCCAGTCGATAAGCTTTTGGGCGCCACCAGAGGTTCATCAGAG
CATTGTCGAATCGTCAGGAAAAGAGCCGAATGGTGAATTTAGTTCGATTGACGTGGTTGGCTGGCTTCTTGAACA
GACGTGCCGCGCAAACGAGCAACTACAAGGACTATTTATTGCACAAGGGCTCAATTTTTGCCGTCGACAAAACGC
AATATTAGAAAACCCTCTCTTTTTGAGCAGTCCGAGCCAGCGATCTGCAGTTTTGAACATTGTAAGGTCTACGGA
GCATCTCACGCTAGATGAGCTCTACGGCAACCAAGGCGGGCGCCAAAATCACGAACCAGTACATGGAGTTAATAG
TAGCCTGCAAGGGCTCGTTGAGCAACTGGATAAGCAAAAGCAAGTCTTTGTGCACGGCGAGTCGTCCATGGTGGC
GAATGCAATGGACGAAGTTGAACAAGAGCGAGAAGTGGAGTTTCAGGTTGAAGAGGTGCGCGAGGTGCAAAAGCC
GAAACATCGAAAAGCACTCTCCTTTCCGGGCCTGCACCAGAGCGTTGCGGCCTTTATACAAACGGGGGTGCTCTC
GGCTGGAGATGGATGCCAGGAGATGAGTGTTTTCTTGGCGCAAACGGCGTTGGGAAAGCAGCACGAGCTTGAAAT
GTCGGGGTCGAGGCTGCTCGTCTCGGAGCAGTTTTTGCGCACAGTTGAAACGGGGACAAATCGTCCCATTGACGA
TAACTATGCCGTGAGTCTTGACTTGCTTGAATTGGGGAAGTGAGGATAGCTCGAGAGCTTACTAACATGACTATT
TGTGAAACAGAGACCAGTCGAGTGGGTTTTATGGAGTCCTGGGACTGGAGTTGCTCTGGTTGTGATTCCTGAAGA
GGCAGAAATCGCCATGCCCCTGATTCGCGCCATGCCGACTCCCATGGTGCATCTCATGACCTATTCTGCTCCCGT
CACGAGACATATGCTGCGATTCGGGCAGCTCGAGTATTACGCCCTTCCCAGTCTCTCGACCAATGATGCGACGCC
CCCGTGGCTAAGCATTGAGCTTGGAATCGTGGGTGCTCGCCTCTACTTTAGTCATGACGAGTACGAGGCATTGCT
CAAGCATCTAAAAGCGTTGGATGGTCAGAGCAGCCAGCAGACGGCAAAGGGAAAGCTCCTTGGGTTTGTTTTTGA
ATGGCTGACGGTGAGGCGCAAAGGACAAGACATTTTGCATACGCCCATGGGATATGTTTGCCAGGGGCGGGCGCT
GGGACAAGGCCATGCCTTTTTTGGCGGTGGCGCCGAAGCGGCAGCGCGTCTAGAGGTGAGAAGCGCGACGGCGTC
GGAAACGGGACACGAGGATCCGAGGGTTTCCGAGGTGGAGGAGGCGACGCAGTCTGAAGAGGACAATGACTCTTT
GGAGGAGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail