Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|109
Gene name
LocationContig_101:428..4846
Strand-
Gene length (bp)4418
Transcript length (bp)4308
Coding sequence length (bp)4308
Protein length (aa) 1436

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00360 PHY Phytochrome region 1.2E-27 634 800
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 1.8E-17 935 1056
PF00072 Response_reg Response regulator receiver domain 6.3E-15 1268 1392
PF01590 GAF GAF domain 1.2E-12 454 620
PF00512 HisKA His Kinase A (phospho-acceptor) domain 2.8E-12 826 888
PF08446 PAS_2 PAS fold 4.0E-08 254 321

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 460 1054 1.0E-56
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 448 1055 6.0E-56
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 251 1038 9.0E-54
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 448 1055 4.0E-50
sp|P55004|PHYE_IPONI Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1 434 803 1.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9R6X3|PHYB_NOSS1 Cyanobacterial phytochrome B OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=bphB PE=3 SV=1 460 1054 1.0E-56
sp|Q55168|PHY1_SYNY3 Phytochrome-like protein cph1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph1 PE=1 SV=1 448 1055 6.0E-56
sp|Q9HWR3|BPHY_PSEAE Bacteriophytochrome OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=bphP PE=1 SV=1 251 1038 9.0E-54
sp|Q9LCC2|PHYA_NOSS1 Cyanobacterial phytochrome A OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=aphA PE=3 SV=1 448 1055 4.0E-50
sp|P55004|PHYE_IPONI Phytochrome E OS=Ipomoea nil GN=PHYE PE=2 SV=1 434 803 1.0E-34
sp|A2XM23|PHYC_ORYSI Phytochrome C OS=Oryza sativa subsp. indica GN=PHYC PE=3 SV=2 434 849 1.0E-33
sp|Q9RZA4|BPHY_DEIRA Bacteriophytochrome OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=bphP PE=1 SV=1 449 1055 3.0E-33
sp|Q10CQ8|PHYC_ORYSJ Phytochrome C OS=Oryza sativa subsp. japonica GN=PHYC PE=2 SV=1 434 849 6.0E-33
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 434 849 1.0E-32
sp|P42498|PHYE_ARATH Phytochrome E OS=Arabidopsis thaliana GN=PHYE PE=1 SV=2 434 803 2.0E-32
sp|P14714|PHYC_ARATH Phytochrome C OS=Arabidopsis thaliana GN=PHYC PE=1 SV=1 434 803 5.0E-32
sp|P42496|PHY_ADICA Phytochrome 1 OS=Adiantum capillus-veneris GN=PHY1 PE=2 SV=2 434 849 7.0E-32
sp|P93528|PHYC_SORBI Phytochrome C OS=Sorghum bicolor GN=PHYC PE=2 SV=1 434 803 1.0E-31
sp|P06592|PHYA_CUCPE Phytochrome A OS=Cucurbita pepo GN=PHYA PE=2 SV=1 434 803 2.0E-31
sp|P42499|PHYB_SOYBN Phytochrome B OS=Glycine max GN=PHYB PE=3 SV=1 434 803 2.0E-31
sp|P14712|PHYA_ARATH Phytochrome A OS=Arabidopsis thaliana GN=PHYA PE=1 SV=2 434 803 2.0E-31
sp|P29130|PHYB_TOBAC Phytochrome B OS=Nicotiana tabacum GN=PHYB PE=2 SV=2 434 822 3.0E-31
sp|P33530|PHYA1_TOBAC Phytochrome A1 OS=Nicotiana tabacum GN=PHYA1 PE=3 SV=1 434 803 3.0E-31
sp|P15001|PHYA_PEA Phytochrome A OS=Pisum sativum GN=PHYA PE=3 SV=1 434 803 1.0E-30
sp|P34094|PHYB_SOLTU Phytochrome B OS=Solanum tuberosum GN=PHYB PE=3 SV=2 434 803 2.0E-30
sp|P93673|PHYA_LATSA Phytochrome type A OS=Lathyrus sativus GN=PHYA PE=3 SV=1 434 803 2.0E-30
sp|P55141|PHYA_PETCR Phytochrome A OS=Petroselinum crispum GN=PHYA PE=2 SV=1 434 823 3.0E-30
sp|O49934|PHYA_POPTM Phytochrome A OS=Populus tremuloides GN=PHYA PE=2 SV=1 434 803 7.0E-30
sp|Q10MG9|PHYB_ORYSJ Phytochrome B OS=Oryza sativa subsp. japonica GN=PHYB PE=2 SV=1 434 803 1.0E-29
sp|A2XFW2|PHYB_ORYSI Phytochrome B OS=Oryza sativa subsp. indica GN=PHYB PE=3 SV=2 434 803 2.0E-29
sp|Q39557|PHY2_CERPU Phytochrome 2 OS=Ceratodon purpureus GN=PHY2 PE=3 SV=1 434 849 3.0E-29
sp|Q9ZS62|PHYB1_SOLLC Phytochrome B1 OS=Solanum lycopersicum GN=PHYB1 PE=2 SV=1 434 803 1.0E-28
sp|P93527|PHYB_SORBI Phytochrome B OS=Sorghum bicolor GN=PHYB PE=3 SV=2 383 803 2.0E-28
sp|Q41046|PHY_PINSY Phytochrome OS=Pinus sylvestris PE=2 SV=1 423 828 4.0E-28
sp|Q40762|PHY_PICAB Phytochrome OS=Picea abies PE=2 SV=1 434 849 7.0E-28
sp|P42500|PHYA_SOYBN Phytochrome A OS=Glycine max GN=PHYA PE=2 SV=1 434 795 8.0E-28
sp|P93526|PHYA_SORBI Phytochrome a OS=Sorghum bicolor GN=PHYA PE=2 SV=1 434 803 2.0E-27
sp|P30733|PHYA_SOLTU Phytochrome A OS=Solanum tuberosum GN=PHYA PE=2 SV=2 434 803 2.0E-27
sp|P25848|PHY1_CERPU Light-sensor Protein kinase OS=Ceratodon purpureus GN=PHY1 PE=3 SV=3 434 828 3.0E-27
sp|P14713|PHYB_ARATH Phytochrome B OS=Arabidopsis thaliana GN=PHYB PE=1 SV=1 434 824 7.0E-27
sp|P36505|PHY1_PHYPA Phytochrome 1 OS=Physcomitrella patens subsp. patens GN=PHY1 PE=2 SV=2 434 849 1.0E-26
sp|P42497|PHYD_ARATH Phytochrome D OS=Arabidopsis thaliana GN=PHYD PE=1 SV=2 434 803 1.0E-26
sp|P19862|PHYA1_MAIZE Phytochrome A OS=Zea mays GN=PHYA1 PE=3 SV=1 434 803 2.0E-26
sp|Q10DU0|PHYA_ORYSJ Phytochrome A OS=Oryza sativa subsp. japonica GN=PHYA PE=2 SV=1 434 803 4.0E-26
sp|A2XLG5|PHYA_ORYSI Phytochrome A OS=Oryza sativa subsp. indica GN=PHYA PE=3 SV=2 434 803 4.0E-26
sp|Q01549|PHY1_SELMA Phytochrome 1 OS=Selaginella martensii GN=PHY1 PE=3 SV=1 434 849 4.0E-26
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 808 1056 9.0E-26
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 812 1059 2.0E-25
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 813 1063 3.0E-25
sp|Q9C5U0|AHK4_ARATH Histidine kinase 4 OS=Arabidopsis thaliana GN=AHK4 PE=1 SV=1 827 1389 4.0E-25
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 801 1050 5.0E-25
sp|A1A697|OHK5_ORYSJ Probable histidine kinase 5 OS=Oryza sativa subsp. japonica GN=HK5 PE=2 SV=1 827 1389 8.0E-25
sp|O14002|MAK2_SCHPO Peroxide stress-activated histidine kinase mak2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak2 PE=3 SV=1 814 1050 1.0E-24
sp|Q9C5U2|AHK2_ARATH Histidine kinase 2 OS=Arabidopsis thaliana GN=AHK2 PE=1 SV=1 827 1391 1.0E-24
sp|P0DMC6|RCSC_ECOLX Sensor histidine kinase RcsC OS=Escherichia coli GN=rcsC PE=1 SV=1 815 1105 2.0E-24
sp|P06594|PHYA4_AVESA Phytochrome A type 4 OS=Avena sativa GN=PHYA4 PE=1 SV=3 434 820 2.0E-24
sp|P0DMC5|RCSC_ECOLI Sensor histidine kinase RcsC OS=Escherichia coli (strain K12) GN=rcsC PE=1 SV=1 815 1105 2.0E-24
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 827 1050 2.0E-24
sp|Q9KLK7|LUXQ_VIBCH Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=luxQ PE=1 SV=1 782 1061 5.0E-24
sp|P0AEC5|BARA_ECOLI Signal transduction histidine-protein kinase BarA OS=Escherichia coli (strain K12) GN=barA PE=1 SV=1 808 1083 8.0E-24
sp|P0AEC6|BARA_ECOL6 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=barA PE=1 SV=1 808 1083 8.0E-24
sp|P0AEC7|BARA_ECO57 Signal transduction histidine-protein kinase BarA OS=Escherichia coli O157:H7 GN=barA PE=3 SV=1 808 1083 8.0E-24
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 814 1055 8.0E-24
sp|P06593|PHYA3_AVESA Phytochrome A type 3 OS=Avena sativa GN=PHYA3 PE=1 SV=3 434 820 2.0E-23
sp|P59342|BARA_SHIFL Signal transduction histidine-protein kinase BarA OS=Shigella flexneri GN=barA PE=3 SV=1 808 1083 2.0E-23
sp|P58363|ARCB_ECO57 Aerobic respiration control sensor protein ArcB OS=Escherichia coli O157:H7 GN=arcB PE=3 SV=1 812 1054 3.0E-23
sp|P0AEC4|ARCB_SHIFL Aerobic respiration control sensor protein ArcB OS=Shigella flexneri GN=arcB PE=3 SV=1 812 1054 4.0E-23
sp|P0AEC3|ARCB_ECOLI Aerobic respiration control sensor protein ArcB OS=Escherichia coli (strain K12) GN=arcB PE=1 SV=1 812 1054 4.0E-23
sp|P58402|EVGS_ECO57 Sensor protein EvgS OS=Escherichia coli O157:H7 GN=evgS PE=3 SV=1 808 1061 8.0E-23
sp|P30855|EVGS_ECOLI Sensor protein EvgS OS=Escherichia coli (strain K12) GN=evgS PE=1 SV=2 813 1061 2.0E-22
sp|P58662|RCSC_SALTY Sensor histidine kinase RcsC OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=rcsC PE=3 SV=1 815 1056 3.0E-22
sp|Q56128|RCSC_SALTI Sensor histidine kinase RcsC OS=Salmonella typhi GN=rcsC PE=3 SV=2 815 1056 5.0E-22
sp|Q53RH0|ERS1_ORYSJ Probable ethylene response sensor 1 OS=Oryza sativa subsp. japonica GN=ERS1 PE=2 SV=1 827 1054 7.0E-22
sp|A2XL32|ERS1_ORYSI Probable ethylene response sensor 1 OS=Oryza sativa subsp. indica GN=ERS1 PE=2 SV=1 827 1054 7.0E-22
sp|Q03228|DIVJ_CAUCR Histidine protein kinase DivJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divJ PE=1 SV=2 808 1058 9.0E-22
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 824 1062 1.0E-21
sp|P06595|PHYA5_AVESA Phytochrome A type 5 (Fragment) OS=Avena sativa GN=PHYA5 PE=1 SV=3 434 624 4.0E-21
sp|P49333|ETR1_ARATH Ethylene receptor 1 OS=Arabidopsis thaliana GN=ETR1 PE=1 SV=1 827 1092 8.0E-21
sp|Q9ZWL6|ETR1_PASED Ethylene receptor OS=Passiflora edulis GN=ETR1 PE=2 SV=1 827 1117 1.0E-20
sp|P26762|BVGS_BORBR Virulence sensor protein BvgS OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=bvgS PE=3 SV=2 814 1062 2.0E-20
sp|Q9SXL4|AHK1_ARATH Histidine kinase 1 OS=Arabidopsis thaliana GN=AHK1 PE=1 SV=2 827 1060 2.0E-20
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 827 1085 2.0E-20
sp|P16575|BVGS_BORPE Virulence sensor protein BvgS OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=bvgS PE=1 SV=3 814 1062 2.0E-20
sp|Q8D5Z6|LUXQ_VIBVU Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain CMCP6) GN=luxQ PE=3 SV=1 827 1055 2.0E-20
sp|P40330|BVGS_BORPA Virulence sensor protein BvgS OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=bvgS PE=3 SV=2 814 1062 3.0E-20
sp|Q7MD16|LUXQ_VIBVY Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio vulnificus (strain YJ016) GN=luxQ PE=3 SV=1 827 1055 3.0E-20
sp|P37894|PLEC_CAUCR Non-motile and phage-resistance protein OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pleC PE=1 SV=2 743 1055 3.0E-20
sp|O49230|ETR1_BRAOL Ethylene receptor 1 OS=Brassica oleracea GN=ETR1 PE=2 SV=1 827 1065 4.0E-20
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 812 1068 7.0E-20
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 809 1056 1.0E-19
sp|P0C0F7|RPFC_XANC8 Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rpfC PE=3 SV=2 827 1066 1.0E-19
sp|P0C0F6|RPFC_XANCP Sensory/regulatory protein RpfC OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rpfC PE=1 SV=2 827 1066 1.0E-19
sp|O82436|ETR1_CUCMN Ethylene receptor 1 OS=Cucumis melo var. cantalupensis GN=ETR1 PE=2 SV=1 827 1054 2.0E-19
sp|O81122|ETR1_MALDO Ethylene receptor OS=Malus domestica GN=ETR1 PE=2 SV=1 827 1065 3.0E-19
sp|Q9XH58|ETR1_PELHO Ethylene receptor 1 OS=Pelargonium hortorum GN=ETR1 PE=2 SV=1 827 1062 4.0E-19
sp|Q9M7M1|ETR1_PRUPE Ethylene receptor OS=Prunus persica GN=ETR1 PE=2 SV=1 827 1056 1.0E-18
sp|Q9SSY6|ETR1_CUCSA Ethylene receptor 1 OS=Cucumis sativus GN=ETR1 PE=2 SV=1 827 1091 1.0E-18
sp|Q41342|ETR1_SOLLC Ethylene receptor 1 OS=Solanum lycopersicum GN=ETR1 PE=1 SV=1 827 1092 4.0E-18
sp|Q87GU5|LUXQ_VIBPA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=luxQ PE=3 SV=1 827 1055 6.0E-18
sp|P23545|PHOR_BACSU Alkaline phosphatase synthesis sensor protein PhoR OS=Bacillus subtilis (strain 168) GN=phoR PE=1 SV=1 827 1055 6.0E-18
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 827 1058 7.0E-18
sp|Q9XH57|ETR2_PELHO Ethylene receptor 2 OS=Pelargonium hortorum GN=ETR2 PE=2 SV=1 827 1062 1.0E-17
sp|O48929|ETR1_TOBAC Ethylene receptor OS=Nicotiana tabacum GN=ETR1 PE=2 SV=1 827 1062 3.0E-17
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 819 1105 4.0E-17
sp|O49187|ETR2_SOLLC Ethylene receptor 2 OS=Solanum lycopersicum GN=ETR2 PE=2 SV=1 833 1066 4.0E-17
sp|Q8FZ86|PDHS_BRUSU Cell-division control histidine kinase PdhS OS=Brucella suis biovar 1 (strain 1330) GN=pdhS PE=3 SV=1 800 1056 6.0E-17
sp|B0CI82|PDHS_BRUSI Cell-division control histidine kinase PdhS OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pdhS PE=3 SV=1 800 1056 6.0E-17
sp|A9M715|PDHS_BRUC2 Cell-division control histidine kinase PdhS OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pdhS PE=3 SV=1 800 1056 6.0E-17
sp|Q57BR6|PDHS_BRUAB Cell-division control histidine kinase PdhS OS=Brucella abortus biovar 1 (strain 9-941) GN=pdhS PE=1 SV=1 800 1056 7.0E-17
sp|Q2YRB4|PDHS_BRUA2 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain 2308) GN=pdhS PE=3 SV=1 800 1056 7.0E-17
sp|B2S758|PDHS_BRUA1 Cell-division control histidine kinase PdhS OS=Brucella abortus (strain S19) GN=pdhS PE=3 SV=1 800 1056 7.0E-17
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 794 1056 8.0E-17
sp|A6X5X4|PDHS_OCHA4 Cell-division control histidine kinase PdhS OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=pdhS PE=3 SV=1 800 1056 8.0E-17
sp|Q8YIM6|PDHS_BRUME Cell-division control histidine kinase PdhS OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pdhS PE=3 SV=2 800 1056 8.0E-17
sp|P58356|TORS_ECO57 Sensor protein TorS OS=Escherichia coli O157:H7 GN=torS PE=3 SV=1 827 1067 1.0E-16
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 827 985 1.0E-16
sp|P54302|LUXQ_VIBHA Autoinducer 2 sensor kinase/phosphatase LuxQ OS=Vibrio harveyi GN=luxQ PE=1 SV=1 827 1055 2.0E-16
sp|A5VRX4|PDHS_BRUO2 Cell-division control histidine kinase PdhS OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pdhS PE=3 SV=1 800 1056 2.0E-16
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 827 985 2.0E-16
sp|Q9HUI3|ARUS_PSEAE Sensor histidine kinase AruS OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=aruS PE=3 SV=1 812 1066 2.0E-16
sp|P39453|TORS_ECOLI Sensor protein TorS OS=Escherichia coli (strain K12) GN=torS PE=1 SV=4 827 1067 2.0E-16
sp|Q38846|ERS1_ARATH Ethylene response sensor 1 OS=Arabidopsis thaliana GN=ERS1 PE=1 SV=1 827 1081 3.0E-16
sp|P77485|CUSS_ECOLI Sensor kinase CusS OS=Escherichia coli (strain K12) GN=cusS PE=1 SV=1 829 1055 5.0E-16
sp|Q0DKM0|ERS2_ORYSJ Probable ethylene response sensor 2 OS=Oryza sativa subsp. japonica GN=ERS2 PE=2 SV=1 827 1061 5.0E-16
sp|Q8XBY4|CUSS_ECO57 Sensor kinase CusS OS=Escherichia coli O157:H7 GN=cusS PE=3 SV=1 829 1055 8.0E-16
sp|B8AY75|ERS2_ORYSI Probable ethylene response sensor 2 OS=Oryza sativa subsp. indica GN=ERS2 PE=2 SV=1 827 1061 8.0E-16
sp|P20169|DSPA_SYNY3 Drug sensory protein A OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dspA PE=3 SV=2 827 1054 2.0E-15
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 786 995 2.0E-15
sp|Q8FK37|CUSS_ECOL6 Sensor kinase CusS OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cusS PE=3 SV=1 829 1055 2.0E-15
sp|P44578|ARCB_HAEIN Aerobic respiration control sensor protein ArcB homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=arcB PE=3 SV=1 819 1026 3.0E-15
sp|O74539|MAK3_SCHPO Peroxide stress-activated histidine kinase mak3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak3 PE=1 SV=1 808 983 3.0E-15
sp|P14377|ZRAS_ECOLI Sensor protein ZraS OS=Escherichia coli (strain K12) GN=zraS PE=1 SV=2 827 1063 8.0E-15
sp|P45608|PHOR_KLEPN Phosphate regulon sensor protein PhoR OS=Klebsiella pneumoniae GN=phoR PE=3 SV=1 825 1055 1.0E-14
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 827 974 1.0E-14
sp|Q52969|Y1002_RHIME Uncharacterized sensor-like histidine kinase R01002 OS=Rhizobium meliloti (strain 1021) GN=R01002 PE=3 SV=2 820 1055 1.0E-14
sp|Q9ZHD4|SILS_SALTM Probable sensor kinase SilS OS=Salmonella typhimurium GN=silS PE=3 SV=1 829 1067 2.0E-14
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 827 1057 3.0E-14
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 827 1056 5.0E-14
sp|A0QR01|SENX3_MYCS2 Signal-transduction histidine kinase senX3 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=senX3 PE=1 SV=1 825 1055 5.0E-14
sp|Q8DMT2|SASA_THEEB Adaptive-response sensory-kinase SasA OS=Thermosynechococcus elongatus (strain BP-1) GN=sasA PE=3 SV=1 832 1055 6.0E-14
sp|Q9RQQ9|DIVL_CAUCR Sensor protein DivL OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=divL PE=1 SV=2 814 1055 6.0E-14
sp|P08400|PHOR_ECOLI Phosphate regulon sensor protein PhoR OS=Escherichia coli (strain K12) GN=phoR PE=1 SV=1 825 1055 7.0E-14
sp|Q8X614|ZRAS_ECO57 Sensor protein ZraS OS=Escherichia coli O157:H7 GN=zraS PE=3 SV=1 827 1063 1.0E-13
sp|Q55E44|DHKE_DICDI Hybrid signal transduction histidine kinase E OS=Dictyostelium discoideum GN=dhkE PE=3 SV=1 827 968 1.0E-13
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 980 1393 1.0E-13
sp|P51392|YCF26_PORPU Uncharacterized sensor-like histidine kinase ycf26 OS=Porphyra purpurea GN=ycf26 PE=3 SV=1 827 1054 1.0E-13
sp|A5A2P0|WALK_STASR Sensor protein kinase WalK (Fragment) OS=Staphylococcus sciuri subsp. rodentium GN=walK PE=3 SV=1 818 1061 2.0E-13
sp|Q9RDT3|WALK_STAAU Sensor protein kinase WalK (Fragment) OS=Staphylococcus aureus GN=walK PE=1 SV=1 807 1061 2.0E-13
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 809 1050 2.0E-13
sp|Q9P7Q7|MAK1_SCHPO Peroxide stress-activated histidine kinase mak1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak1 PE=3 SV=1 1244 1396 3.0E-13
sp|O22267|CKI1_ARATH Histidine kinase CKI1 OS=Arabidopsis thaliana GN=CKI1 PE=1 SV=1 828 1064 3.0E-13
sp|Q08430|KINB_BACSU Sporulation kinase B OS=Bacillus subtilis (strain 168) GN=kinB PE=3 SV=4 827 1059 3.0E-13
sp|Q1XD95|YCF26_PYRYE Uncharacterized sensor-like histidine kinase ycf26 OS=Pyropia yezoensis GN=ycf26 PE=3 SV=1 827 1054 4.0E-13
sp|Q95PI2|DHKC_DICDI Hybrid signal transduction histidine kinase C OS=Dictyostelium discoideum GN=dhkC PE=1 SV=1 815 1063 8.0E-13
sp|P45609|PHOR_SHIDY Phosphate regulon sensor protein PhoR OS=Shigella dysenteriae GN=phoR PE=3 SV=1 825 1055 8.0E-13
sp|P94414|YCLK_BACSU Sensor histidine kinase YclK OS=Bacillus subtilis (strain 168) GN=yclK PE=3 SV=1 825 1061 2.0E-12
sp|P9WGK5|SENX3_MYCTU Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=senX3 PE=1 SV=1 825 1055 2.0E-12
sp|P9WGK4|SENX3_MYCTO Sensor-like histidine kinase senX3 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=senX3 PE=3 SV=1 825 1055 2.0E-12
sp|P0A601|SENX3_MYCBO Sensor-like histidine kinase senX3 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=senX3 PE=3 SV=1 825 1055 2.0E-12
sp|Q86AT9|DHKI_DICDI Hybrid signal transduction histidine kinase I OS=Dictyostelium discoideum GN=dhkI-1 PE=3 SV=1 1266 1389 2.0E-12
sp|O69729|TCRY_MYCTU Probable sensor histidine kinase TcrY OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=tcrY PE=1 SV=1 825 1064 4.0E-12
sp|Q2JWK9|SASA_SYNJA Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-3-3Ab) GN=sasA PE=3 SV=1 827 1055 9.0E-12
sp|Q55434|PHY2_SYNY3 Phytochrome-like protein cph2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=cph2 PE=1 SV=1 440 599 9.0E-12
sp|A1A699|OHK6_ORYSJ Probable histidine kinase 6 OS=Oryza sativa subsp. japonica GN=HK6 PE=1 SV=1 1268 1394 1.0E-11
sp|B7K3M6|SASA_CYAP8 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 8801) GN=sasA PE=3 SV=1 812 1055 1.0E-11
sp|Q2JKD9|SASA_SYNJB Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=sasA PE=3 SV=1 827 1055 2.0E-11
sp|Q55630|SASA_SYNY3 Adaptive-response sensory-kinase SasA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sasA PE=3 SV=1 812 1055 3.0E-11
sp|Q8CU87|WALK_STAES Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 12228) GN=walK PE=1 SV=1 819 1061 3.0E-11
sp|Q5HK19|WALK_STAEQ Sensor protein kinase WalK OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=walK PE=1 SV=1 819 1061 3.0E-11
sp|A6QD58|WALK_STAAE Sensor protein kinase WalK OS=Staphylococcus aureus (strain Newman) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q7A215|WALK_STAAW Sensor protein kinase WalK OS=Staphylococcus aureus (strain MW2) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|A8YYU2|WALK_STAAT Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q6GD71|WALK_STAAS Sensor protein kinase WalK OS=Staphylococcus aureus (strain MSSA476) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q7A8E0|WALK_STAAN Sensor protein kinase WalK OS=Staphylococcus aureus (strain N315) GN=walK PE=1 SV=1 819 1061 4.0E-11
sp|Q7A305|WALK_STAAM Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q5HJX6|WALK_STAAC Sensor protein kinase WalK OS=Staphylococcus aureus (strain COL) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q2YUQ2|WALK_STAAB Sensor protein kinase WalK OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|A5INR0|WALK_STAA9 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH9) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q2G2U4|WALK_STAA8 Sensor protein kinase WalK OS=Staphylococcus aureus (strain NCTC 8325) GN=walK PE=1 SV=1 819 1061 4.0E-11
sp|Q2FKN7|WALK_STAA3 Sensor protein kinase WalK OS=Staphylococcus aureus (strain USA300) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|A6TXG9|WALK_STAA2 Sensor protein kinase WalK OS=Staphylococcus aureus (strain JH1) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|A7WWQ7|WALK_STAA1 Sensor protein kinase WalK OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=walK PE=3 SV=1 819 1061 4.0E-11
sp|Q7A5H7|SRRB_STAAN Sensor protein SrrB OS=Staphylococcus aureus (strain N315) GN=srrB PE=1 SV=2 822 1055 4.0E-11
sp|Q99TZ9|SRRB_STAAM Sensor protein SrrB OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=srrB PE=3 SV=2 822 1055 4.0E-11
sp|Q9L523|SRRB_STAAU Sensor protein SrrB OS=Staphylococcus aureus GN=srrB PE=2 SV=1 822 1055 5.0E-11
sp|Q8NWF3|SRRB_STAAW Sensor protein SrrB OS=Staphylococcus aureus (strain MW2) GN=srrB PE=3 SV=2 822 1055 5.0E-11
sp|Q6G973|SRRB_STAAS Sensor protein SrrB OS=Staphylococcus aureus (strain MSSA476) GN=srrB PE=3 SV=2 822 1055 5.0E-11
sp|Q5HFT1|SRRB_STAAC Sensor protein SrrB OS=Staphylococcus aureus (strain COL) GN=srrB PE=2 SV=1 822 1055 5.0E-11
sp|Q2FY80|SRRB_STAA8 Sensor protein SrrB OS=Staphylococcus aureus (strain NCTC 8325) GN=srrB PE=3 SV=1 822 1055 5.0E-11
sp|Q45614|YYCG_BACSU Sensor histidine kinase YycG OS=Bacillus subtilis (strain 168) GN=yycG PE=1 SV=1 825 1061 5.0E-11
sp|Q6GGK7|SRRB_STAAR Sensor protein SrrB OS=Staphylococcus aureus (strain MRSA252) GN=srrB PE=3 SV=2 822 1055 5.0E-11
sp|A1A698|OHK4_ORYSJ Probable histidine kinase 4 OS=Oryza sativa subsp. japonica GN=HK4 PE=2 SV=1 1256 1389 7.0E-11
sp|P54883|SEX3_MYCLE Sensor-like histidine kinase senX3 OS=Mycobacterium leprae (strain TN) GN=senX3 PE=3 SV=1 825 1059 7.0E-11
sp|Q3S4A7|AHK5_ARATH Histidine kinase 5 OS=Arabidopsis thaliana GN=AHK5 PE=1 SV=1 1238 1398 1.0E-10
sp|E0X9C7|TODS_PSEPT Sensor histidine kinase TodS OS=Pseudomonas putida (strain DOT-T1E) GN=todS PE=1 SV=1 795 1060 1.0E-10
sp|P30847|BAES_ECOLI Signal transduction histidine-protein kinase BaeS OS=Escherichia coli (strain K12) GN=baeS PE=1 SV=2 805 1056 1.0E-10
sp|Q742C0|MPRB_MYCPA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mprB PE=3 SV=2 827 1108 1.0E-10
sp|A5W4E3|TODS_PSEP1 Sensor histidine kinase TodS OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=todS PE=1 SV=1 827 1060 1.0E-10
sp|B1WYT4|SASA_CYAA5 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain ATCC 51142) GN=sasA PE=3 SV=1 812 1055 1.0E-10
sp|Q6GKS6|WALK_STAAR Sensor protein kinase WalK OS=Staphylococcus aureus (strain MRSA252) GN=walK PE=3 SV=1 819 1061 1.0E-10
sp|Q54RP6|DHKL_DICDI Hybrid signal transduction histidine kinase L OS=Dictyostelium discoideum GN=dhkL PE=3 SV=1 1266 1384 2.0E-10
sp|Q9P4U6|TCSB_EMENI Two-component system protein B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsB PE=1 SV=2 809 1080 2.0E-10
sp|A3BE68|OHK1_ORYSJ Probable histidine kinase 1 OS=Oryza sativa subsp. japonica GN=HK1 PE=2 SV=1 825 970 3.0E-10
sp|B0JK50|SASA_MICAN Adaptive-response sensory-kinase SasA OS=Microcystis aeruginosa (strain NIES-843) GN=sasA PE=3 SV=1 778 1055 3.0E-10
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 825 970 4.0E-10
sp|B7KFU0|SASA_CYAP7 Adaptive-response sensory-kinase SasA OS=Cyanothece sp. (strain PCC 7424) GN=sasA PE=3 SV=1 797 1055 4.0E-10
sp|Q5A599|NIK1_CANAL Histidine protein kinase NIK1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=NIK1 PE=1 SV=2 1229 1427 5.0E-10
sp|Q4LAJ8|WALK_STAHJ Sensor protein kinase WalK OS=Staphylococcus haemolyticus (strain JCSC1435) GN=walK PE=3 SV=1 819 1055 6.0E-10
sp|A2YFR6|OHK1_ORYSI Probable histidine kinase 1 OS=Oryza sativa subsp. indica GN=HK1 PE=3 SV=1 1252 1393 7.0E-10
sp|P35164|RESE_BACSU Sensor histidine kinase ResE OS=Bacillus subtilis (strain 168) GN=resE PE=1 SV=1 822 1055 7.0E-10
sp|A0QBR0|MPRB_MYCA1 Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium avium (strain 104) GN=mprB PE=3 SV=2 827 1087 8.0E-10
sp|Q4A159|WALK_STAS1 Sensor protein kinase WalK OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=walK PE=3 SV=1 819 1061 8.0E-10
sp|Q8Z332|ZRAS_SALTI Sensor protein ZraS OS=Salmonella typhi GN=zraS PE=3 SV=1 827 1055 8.0E-10
sp|Q8KIY1|TMOS_PSEME Sensor histidine kinase TmoS OS=Pseudomonas mendocina GN=tmoS PE=1 SV=1 799 1060 9.0E-10
sp|Q9APE0|ZRAS_KLEOX Sensor protein ZraS OS=Klebsiella oxytoca GN=zraS PE=3 SV=1 814 1057 1.0E-09
sp|Q54YZ9|DHKJ_DICDI Hybrid signal transduction histidine kinase J OS=Dictyostelium discoideum GN=dhkJ PE=3 SV=2 1268 1393 2.0E-09
sp|Q551X9|DHKF_DICDI Hybrid signal transduction histidine kinase F OS=Dictyostelium discoideum GN=dhkF PE=3 SV=1 1266 1393 2.0E-09
sp|P37461|ZRAS_SALTY Sensor protein ZraS OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zraS PE=2 SV=2 827 1055 2.0E-09
sp|Q06904|SASA_SYNE7 Adaptive-response sensory-kinase SasA OS=Synechococcus elongatus (strain PCC 7942) GN=sasA PE=1 SV=2 807 1055 3.0E-09
sp|Q7U871|SASA_SYNPX Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain WH8102) GN=sasA PE=3 SV=1 827 1056 3.0E-09
sp|Q5AHA0|CHK1_CANAL Histidine protein kinase 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=CHK1 PE=2 SV=1 1235 1384 5.0E-09
sp|Q54Q69|DHKG_DICDI Hybrid signal transduction histidine kinase G OS=Dictyostelium discoideum GN=dhkG PE=3 SV=1 1265 1394 5.0E-09
sp|P39764|KINC_BACSU Sporulation kinase C OS=Bacillus subtilis (strain 168) GN=kinC PE=3 SV=1 806 1056 5.0E-09
sp|Q75KW7|ORR41_ORYSJ Two-component response regulator ORR41 OS=Oryza sativa subsp. japonica GN=RR41 PE=3 SV=1 1261 1394 5.0E-09
sp|Q9C5U1|AHK3_ARATH Histidine kinase 3 OS=Arabidopsis thaliana GN=AHK3 PE=1 SV=1 1266 1389 6.0E-09
sp|Q9M8Y4|ARR22_ARATH Two-component response regulator ARR22 OS=Arabidopsis thaliana GN=ARR22 PE=2 SV=1 1262 1394 7.0E-09
sp|Q5A872|SLN1_CANAL Histidine protein kinase SLN1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SLN1 PE=1 SV=1 1265 1393 7.0E-09
sp|Q9P896|TCSA_EMENI Two-component system protein A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tcsA PE=3 SV=2 1267 1393 1.0E-08
sp|Q54SK5|DHKM_DICDI Hybrid signal transduction histidine kinase M OS=Dictyostelium discoideum GN=dhkM PE=3 SV=1 1268 1393 1.0E-08
sp|A2C884|SASA_PROM3 Adaptive-response sensory-kinase SasA OS=Prochlorococcus marinus (strain MIT 9303) GN=sasA PE=3 SV=1 832 1055 1.0E-08
sp|P9WGK9|MTRB_MYCTU Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mtrB PE=1 SV=1 798 1056 1.0E-08
sp|Q54SP4|DHKD_DICDI Hybrid signal transduction histidine kinase D OS=Dictyostelium discoideum GN=dhkD PE=2 SV=1 827 1056 2.0E-08
sp|P9WGK8|MTRB_MYCTO Sensor histidine kinase MtrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mtrB PE=3 SV=1 798 1056 2.0E-08
sp|P59963|MTRB_MYCBO Sensor histidine kinase MtrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mtrB PE=3 SV=1 798 1056 2.0E-08
sp|A7HD43|GCHK_ANADF Globin-coupled histidine kinase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=gchK PE=1 SV=1 799 1055 2.0E-08
sp|Q49ZT9|HSSS_STAS1 Heme sensor protein HssS OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=hssS PE=3 SV=1 802 1052 3.0E-08
sp|O31671|KIND_BACSU Sporulation kinase D OS=Bacillus subtilis (strain 168) GN=kinD PE=1 SV=1 819 1055 4.0E-08
sp|Q5A4X5|SKN7_CANAL Transcription factor SKN7 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SKN7 PE=3 SV=1 1241 1394 4.0E-08
sp|B2J946|SASA_NOSP7 Adaptive-response sensory-kinase SasA OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=sasA PE=3 SV=1 827 1055 6.0E-08
sp|Q54W36|DHKH_DICDI Hybrid signal transduction histidine kinase H OS=Dictyostelium discoideum GN=dhkH PE=3 SV=1 805 962 6.0E-08
sp|Q86CZ2|DHKK_DICDI Hybrid signal transduction histidine kinase K OS=Dictyostelium discoideum GN=dhkK PE=1 SV=1 1262 1400 7.0E-08
sp|P48027|GACS_PSESY Sensor protein GacS OS=Pseudomonas syringae pv. syringae GN=gacS PE=3 SV=1 1263 1389 8.0E-08
sp|Q869S5|DOKA_DICDI Hybrid signal transduction protein dokA OS=Dictyostelium discoideum GN=dokA PE=1 SV=1 1253 1394 9.0E-08
sp|P38889|SKN7_YEAST Transcription factor SKN7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SKN7 PE=1 SV=1 1238 1393 9.0E-08
sp|Q93CB7|MTRB_MYCPA Sensor histidine kinase MtrB OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mtrB PE=3 SV=1 823 1056 9.0E-08
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase B OS=Dictyostelium discoideum GN=dhkB PE=1 SV=1 1255 1384 1.0E-07
sp|Q03069|DEGM_BACB2 Sensor protein DegM OS=Bacillus sp. (strain B21-2) GN=degM PE=3 SV=1 827 1055 1.0E-07
sp|O34206|KINB_PSEAI Alginate biosynthesis sensor protein KinB OS=Pseudomonas aeruginosa GN=kinB PE=1 SV=1 831 1055 1.0E-07
sp|A1A696|OHK3_ORYSJ Probable histidine kinase 3 OS=Oryza sativa subsp. japonica GN=HK3 PE=2 SV=1 1266 1389 2.0E-07
sp|A2WYI4|OHK3_ORYSI Probable histidine kinase 3 OS=Oryza sativa subsp. indica GN=HK3 PE=2 SV=1 1266 1389 2.0E-07
sp|P94608|KDPD_CLOAB Sensor protein KdpD OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpD PE=3 SV=2 813 1061 2.0E-07
sp|Q3AYV8|SASA_SYNS9 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9902) GN=sasA PE=3 SV=1 827 1056 2.0E-07
sp|P39928|SLN1_YEAST Osmosensing histidine protein kinase SLN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLN1 PE=1 SV=1 1240 1394 2.0E-07
sp|Q9CCJ1|MTRB_MYCLE Sensor histidine kinase MtrB OS=Mycobacterium leprae (strain TN) GN=mtrB PE=3 SV=1 823 1056 2.0E-07
sp|P71380|PHOR_HAEIN Phosphate regulon sensor protein PhoR OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=phoR PE=3 SV=1 818 1055 2.0E-07
sp|P43501|PILH_PSEAE Protein PilH OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pilH PE=3 SV=1 1266 1395 4.0E-07
sp|Q9ZTP3|EIN4_ARATH Protein EIN4 OS=Arabidopsis thaliana GN=EIN4 PE=1 SV=1 1263 1384 5.0E-07
sp|Q7A0W5|ARLS_STAAW Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MW2) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q6G9E7|ARLS_STAAS Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MSSA476) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q7A5N3|ARLS_STAAN Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain N315) GN=arlS PE=1 SV=1 790 1052 8.0E-07
sp|Q7A2R7|ARLS_STAAM Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q5HG05|ARLS_STAAC Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain COL) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q9KJN3|ARLS_STAA8 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain NCTC 8325) GN=arlS PE=1 SV=1 790 1052 8.0E-07
sp|Q2FH24|ARLS_STAA3 Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain USA300) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q0IBF4|SASA_SYNS3 Adaptive-response sensory-kinase SasA OS=Synechococcus sp. (strain CC9311) GN=sasA PE=3 SV=1 827 1056 8.0E-07
sp|Q6GGZ4|ARLS_STAAR Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain MRSA252) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q2YY04|ARLS_STAAB Signal transduction histidine-protein kinase ArlS OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=arlS PE=3 SV=1 790 1052 8.0E-07
sp|Q5SML4|OHK2_ORYSJ Probable histidine kinase 2 OS=Oryza sativa subsp. japonica GN=HK2 PE=2 SV=1 828 965 8.0E-07
sp|A2YA15|OHK2_ORYSI Probable histidine kinase 2 OS=Oryza sativa subsp. indica GN=HK2 PE=3 SV=1 828 965 8.0E-07
sp|P33529|PHY_MOUSC Phytochrome OS=Mougeotia scalaris GN=PHY PE=2 SV=2 828 1060 1.0E-06
sp|Q06067|ATOS_ECOLI Signal transduction histidine-protein kinase AtoS OS=Escherichia coli (strain K12) GN=atoS PE=3 SV=1 819 1057 1.0E-06
sp|Q9KM66|CQSS_VIBCH CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cqsS PE=1 SV=1 829 1055 1.0E-06
sp|Q54U87|DHKA_DICDI Hybrid signal transduction histidine kinase A OS=Dictyostelium discoideum GN=dhkA PE=1 SV=1 1266 1394 2.0E-06
sp|A7N6S2|CQSS_VIBCB CAI-1 autoinducer sensor kinase/phosphatase CqsS OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cqsS PE=1 SV=1 829 1092 2.0E-06
sp|E5KK10|FILI_METH6 Methanogenesis regulatory histidine kinase FilI OS=Methanosaeta harundinacea (strain 6Ac) GN=filI PE=1 SV=1 812 1055 2.0E-06
sp|P08982|ENVZ_SALTY Osmolarity sensor protein EnvZ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=envZ PE=3 SV=2 826 1055 4.0E-06
sp|P42245|YCBM_BACSU Sensor histidine kinase YcbM OS=Bacillus subtilis (strain 168) GN=ycbM PE=3 SV=2 827 1054 4.0E-06
sp|P9WGK7|PRRB_MYCTU Sensor-type histidine kinase PrrB OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=prrB PE=1 SV=1 792 1055 6.0E-06
sp|P9WGK6|PRRB_MYCTO Sensor-type histidine kinase PrrB OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=prrB PE=3 SV=1 792 1055 6.0E-06
sp|P0A5Z9|PRRB_MYCBO Sensor-type histidine kinase PrrB OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=prrB PE=3 SV=1 792 1055 6.0E-06
sp|Q4L8M0|HSSS_STAHJ Heme sensor protein HssS OS=Staphylococcus haemolyticus (strain JCSC1435) GN=hssS PE=3 SV=1 809 1055 7.0E-06
sp|A0PWB3|MPRB_MYCUA Signal transduction histidine-protein kinase/phosphatase MprB OS=Mycobacterium ulcerans (strain Agy99) GN=mprB PE=3 SV=1 827 1095 7.0E-06
sp|P16497|KINA_BACSU Sporulation kinase A OS=Bacillus subtilis (strain 168) GN=kinA PE=1 SV=2 827 1055 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0006355 regulation of transcription, DNA-templated Yes
GO:0009584 detection of visible light Yes
GO:0000155 phosphorelay sensor kinase activity Yes
GO:0007165 signal transduction Yes
GO:0018298 obsolete protein-chromophore linkage Yes
GO:0000160 phosphorelay signal transduction system Yes
GO:0019219 regulation of nucleobase-containing compound metabolic process No
GO:0031323 regulation of cellular metabolic process No
GO:0016301 kinase activity No
GO:0008150 biological_process No
GO:0080090 regulation of primary metabolic process No
GO:0035556 intracellular signal transduction No
GO:0060255 regulation of macromolecule metabolic process No
GO:0010468 regulation of gene expression No
GO:0009605 response to external stimulus No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0050789 regulation of biological process No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0051606 detection of stimulus No
GO:0009583 detection of light stimulus No
GO:0019222 regulation of metabolic process No
GO:2001141 regulation of RNA biosynthetic process No
GO:1903506 regulation of nucleic acid-templated transcription No
GO:0140096 catalytic activity, acting on a protein No
GO:0050794 regulation of cellular process No
GO:0016740 transferase activity No
GO:0009628 response to abiotic stimulus No
GO:0140299 small molecule sensor activity No
GO:0051252 regulation of RNA metabolic process No
GO:0003824 catalytic activity No
GO:0004672 protein kinase activity No
GO:0009416 response to light stimulus No
GO:0010556 regulation of macromolecule biosynthetic process No
GO:0051171 regulation of nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0016775 phosphotransferase activity, nitrogenous group as acceptor No
GO:0009582 detection of abiotic stimulus No
GO:0005488 binding No
GO:0004673 protein histidine kinase activity No
GO:0050896 response to stimulus No
GO:0065007 biological regulation No
GO:0009314 response to radiation No
GO:0009889 regulation of biosynthetic process No
GO:0009987 cellular process No
GO:0009581 detection of external stimulus No
GO:0031326 regulation of cellular biosynthetic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup935
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|109 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7022
Ophiocordyceps camponoti-floridani Ophcf2|01137
Ophiocordyceps camponoti-rufipedis Ophun1|5953
Ophiocordyceps kimflemingae Ophio5|4324
Ophiocordyceps subramaniannii Hirsu2|679

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|109
MDQPLPSPSSPQQDAEPPPRPPPQDQQHGATRQSSPKASPSPPHSLATINGHSRGAASSSWSTGSERQVGPSYAA
SEMSTDRVFPIRSVVSLNPAPAGRRNSLSEDGLVHGTNDSGSASLHRRTSSLRLQATRDEFRRADTLPPLPTSPS
HLDHAAAYVRRKRAMSGPFSSIQADAARKGTIAPLHLNISASDLESEESEVAPDPDTARMSNASALSRQQSLDEV
PHVTTRFTHVESESGHSVITGRDGVLQRCEDEPIHTPGAVQGFGTLLALREEQDGSFVVRYVSENSEKILGYSPG
HLFKLKSFMQILTEEQQDNLLDHIDFIRDEDADASANGPEVLSLSIRSPKKRRNVKLWCAIHINPAHPELIICEF
ELDDDVEFPLRPPDELTPNMPHDTLHSNPTLEEIEESTEILSKPLRILRSARKRRGEQGAMQVFDIMSQVQEQLA
SAPNLDAFLKVLVGIVKELTGFHRVMVYQFDSAYNGKVVTELVDTSQTIDLYKGLHFPASDIPRQARQLYTINKV
RLLYDRDMETARIVCRSQEDLELPLDMTHAYLRAMSPIHLKYLANMAVRSSMSISINAFDELWGLIACHSYGPRG
MRVSFPIRKMCRLVGDTASQNIERLSYASRLQARKLINTAPTDKNPSGYIIASSDDLLKLFDADFGLLSIKGETK
ILGVMEQSQEALAMLEYLRMRKLTAVLASHDVSEDFPDLGYPPGFRILAGLLYVPLSVGGNDFIVFFRQGQIREV
KWAGNPYEKTVREGTAGFLEPRSSFKTWSESVVGQCREWNEEQIETAAVLCLVYGKFIEVWRQKEAALQNSRLTR
LLLANSAHEVRTPLNAIINYLEIALEGSLDQETRENLARSHSASKSLIYVINDLLDLTKTEEGQNLIKDEIFDLS
TCVKEATDAYHVDAKRKNIEYHVIQHPGLPQAVHGDGRRVRQAISNVTANAIANTQNGAVTVEVFVVEARERQAV
VEFVVEDTGSGMSPKQLDALFRDLEQVSSEDSERRLSSDRSSRTLGLGLAMVARIVRNMDGQLRLKSETGQGSRF
VVQLPFNLPEESPPSTCTGKSSVETAQSTSSSSGVVALASEQLKAAPEGEMLLIDGSSLAANATSAEGSVNAENA
SAGSRRSMSSLGSLGSQRSDAERLINAIQTPLSLNENQAGGYFASRRDSRSSQVQAAASLSSSMTLSPSKNPLSG
LKLPRSEAGGSVEVRDSRTPVRPVKVPETYVDVPDALLQLPSNQAAVASRSRSNTSTSSHGQRVLRTLIADDDPI
NLKVLRKRLEKAGHQVHHAVNGEDCASLYCGDSSSFDAILMDMQMPIVDGLTSTKMIRCMELSPQHGGHSELAAA
NGRIPIFAVSASLVEHDRLVYINAGFDGWILKPIDFKRLNTLLSGIQHQETRNECLYSPGQWERGGWFVKRHEPP
ATPAHEATTP*
Coding >OphauG2|109
ATGGACCAGCCGTTGCCGTCGCCCTCGTCGCCGCAGCAGGATGCTGAGCCGCCGCCGCGGCCACCCCCCCAGGAC
CAGCAGCATGGTGCTACACGGCAAAGCTCCCCCAAAGCCTCTCCGTCTCCTCCACATTCTCTGGCAACAATAAAC
GGCCATTCCAGAGGCGCCGCCAGTTCGTCGTGGAGTACTGGTTCGGAGCGACAAGTCGGTCCCTCGTATGCCGCC
TCAGAAATGTCGACCGACCGAGTCTTTCCCATACGCTCCGTCGTCAGCTTAAACCCCGCTCCTGCAGGCAGGCGA
AATTCCTTGTCGGAAGATGGCCTGGTCCATGGCACAAATGACAGCGGATCGGCGTCCCTTCATCGACGTACCTCT
TCTCTGAGACTGCAGGCCACGAGGGACGAGTTTAGAAGAGCCGACACGCTGCCTCCTTTACCAACCAGCCCCTCT
CACCTGGACCACGCAGCAGCCTATGTTCGCAGAAAACGGGCCATGAGCGGGCCCTTTTCCAGCATCCAGGCAGAT
GCAGCTCGAAAGGGCACCATTGCACCTCTGCATCTTAACATCTCGGCGTCGGACCTGGAGTCTGAAGAGTCGGAA
GTTGCCCCAGACCCTGACACTGCGCGGATGAGCAACGCTTCGGCTCTATCTCGCCAACAGTCGCTGGATGAAGTG
CCTCATGTCACGACGCGCTTCACCCACGTCGAGTCTGAAAGTGGACACTCCGTCATTACAGGGCGAGACGGCGTG
CTGCAGCGCTGTGAAGACGAGCCCATCCACACGCCTGGAGCCGTACAGGGCTTTGGCACCCTGTTGGCGCTCCGC
GAGGAACAAGACGGAAGCTTTGTCGTTCGCTATGTCAGCGAAAATTCAGAAAAAATACTCGGCTACAGCCCCGGT
CATCTCTTCAAGCTCAAGAGCTTCATGCAAATTTTGACCGAGGAACAGCAAGACAACCTGCTCGACCACATCGAC
TTTATTCGCGATGAGGATGCCGATGCTTCAGCCAACGGTCCCGAAGTCCTCAGCTTGTCGATTCGTTCCCCCAAG
AAGCGCCGCAACGTCAAGCTCTGGTGCGCCATCCATATCAACCCGGCCCATCCCGAGCTCATCATCTGCGAGTTT
GAGCTCGACGACGACGTTGAGTTTCCGCTTCGCCCGCCGGATGAGCTGACGCCCAACATGCCACACGACACCCTG
CACTCGAACCCGACGCTCGAGGAGATTGAAGAGAGCACAGAAATACTCAGCAAGCCGCTGCGCATCCTTCGTAGC
GCTAGAAAGCGCAGAGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCGCAGGTTCAAGAACAGCTCGCC
TCAGCCCCCAACCTGGATGCTTTTCTCAAGGTTCTTGTCGGTATCGTCAAGGAGCTGACTGGCTTCCACCGCGTC
ATGGTGTATCAATTCGACTCGGCCTACAACGGCAAGGTGGTGACGGAACTTGTTGACACGTCGCAGACTATTGAC
TTGTACAAGGGTCTTCACTTTCCGGCATCTGACATTCCCCGGCAAGCTCGCCAGCTCTACACCATCAACAAGGTG
CGGCTTTTGTACGACCGAGACATGGAGACGGCTCGAATTGTTTGCCGCTCTCAAGAGGATCTCGAGCTCCCCTTG
GACATGACGCATGCCTATCTGAGAGCAATGTCTCCGATCCATCTTAAGTATTTGGCCAACATGGCGGTGCGATCG
TCCATGTCCATCTCCATCAATGCTTTTGATGAGCTTTGGGGGCTAATTGCCTGTCATTCTTATGGCCCCCGTGGG
ATGCGAGTCTCGTTTCCCATTCGCAAGATGTGTCGCCTTGTTGGAGACACTGCCTCTCAAAACATTGAGAGATTG
TCGTATGCCTCGAGGCTACAGGCGCGGAAACTCATCAATACTGCGCCTACGGACAAGAATCCGTCTGGATACATT
ATCGCTTCGTCGGATGATCTGTTGAAGCTGTTTGATGCTGATTTTGGTCTGCTGTCAATCAAGGGCGAGACCAAA
ATTCTGGGTGTCATGGAGCAGAGCCAGGAAGCGCTGGCCATGTTGGAGTATCTGCGGATGCGCAAGCTGACGGCC
GTCTTGGCTTCGCACGACGTTAGCGAGGACTTTCCCGACCTTGGATACCCTCCGGGCTTTCGAATCCTTGCCGGC
CTGCTCTACGTTCCGTTGAGTGTGGGAGGCAACGATTTTATAGTCTTTTTCCGCCAGGGGCAGATAAGAGAAGTC
AAGTGGGCGGGTAATCCTTATGAAAAGACGGTTCGTGAGGGGACGGCTGGCTTTTTGGAGCCGCGGTCGAGCTTC
AAGACGTGGAGCGAGTCCGTGGTTGGACAGTGTCGGGAATGGAACGAGGAGCAAATCGAGACGGCAGCTGTACTG
TGCCTGGTTTATGGCAAATTCATTGAAGTCTGGCGGCAAAAGGAGGCGGCTCTACAGAACAGCAGGCTGACGAGG
CTGCTGCTGGCCAATTCGGCGCACGAGGTGCGCACACCTCTAAATGCCATTATCAATTACCTGGAGATTGCGCTC
GAAGGGTCTCTGGATCAAGAGACGCGGGAAAACCTGGCGCGGTCTCACTCGGCGTCCAAGTCGTTGATATACGTC
ATCAATGATTTGCTGGACCTGACCAAGACGGAGGAGGGGCAGAATTTGATCAAGGACGAAATATTCGACTTGTCG
ACGTGCGTCAAGGAGGCGACGGATGCGTACCATGTGGATGCCAAGAGGAAGAACATTGAGTATCATGTTATACAG
CATCCCGGGCTTCCACAGGCTGTGCACGGAGACGGGCGGCGCGTCAGGCAAGCCATCTCCAACGTGACGGCAAAT
GCCATTGCGAACACGCAAAACGGCGCTGTCACGGTGGAAGTGTTTGTTGTCGAAGCGCGAGAGCGCCAAGCAGTG
GTGGAATTTGTGGTTGAAGACACGGGCTCTGGCATGAGCCCCAAGCAACTCGATGCTCTCTTCCGCGATCTCGAG
CAGGTCAGCAGCGAGGATAGCGAGCGCAGACTATCGTCGGATCGCAGCTCGCGGACGCTGGGCCTCGGGCTGGCC
ATGGTGGCCCGCATCGTCAGAAACATGGATGGACAGCTGCGCCTCAAGTCGGAGACGGGCCAGGGATCCAGGTTT
GTCGTCCAGCTGCCCTTCAACCTGCCCGAGGAATCGCCCCCGTCCACGTGCACTGGCAAGAGCAGCGTCGAGACG
GCGCAGAGCACGTCGTCGTCGAGTGGCGTGGTGGCGTTGGCATCGGAGCAGCTCAAGGCAGCTCCAGAAGGCGAG
ATGCTGCTGATTGATGGCAGCAGCCTTGCCGCCAACGCGACGTCGGCAGAAGGCAGTGTCAATGCTGAAAATGCA
AGCGCAGGAAGCCGGCGAAGCATGAGCAGCCTGGGCAGCCTGGGCAGCCAGCGGAGCGACGCGGAGCGCCTCATC
AATGCCATTCAAACGCCGCTTTCTCTCAACGAAAACCAGGCCGGCGGCTATTTTGCCAGTCGGCGAGACTCGCGC
AGCAGCCAGGTGCAGGCGGCCGCTAGCCTGTCCAGCTCAATGACGCTTTCGCCGAGCAAGAATCCTCTGTCGGGC
CTCAAGCTTCCTCGCTCAGAGGCGGGAGGCAGTGTTGAGGTGCGCGACTCGAGAACGCCAGTCCGGCCTGTCAAG
GTGCCAGAGACGTACGTGGATGTGCCCGACGCCTTGTTGCAATTGCCGAGCAATCAAGCTGCAGTCGCCAGTCGA
AGCAGAAGCAACACCAGCACTAGCTCCCATGGCCAACGAGTTCTGCGCACCCTCATTGCCGACGACGATCCCATC
AATCTCAAGGTGCTGCGGAAGAGGCTGGAAAAGGCTGGCCACCAAGTGCACCATGCTGTCAATGGTGAAGACTGC
GCCAGCTTGTACTGCGGAGATTCGTCGTCTTTTGATGCCATCTTGATGGACATGCAGATGCCCATTGTCGACGGT
CTCACTAGCACCAAGATGATTCGATGCATGGAGCTTTCTCCCCAACATGGAGGCCACTCTGAACTGGCCGCGGCA
AACGGCCGCATTCCCATATTTGCCGTGTCAGCCTCTCTAGTGGAGCACGATAGGCTGGTATATATCAATGCGGGA
TTCGATGGCTGGATCCTCAAGCCCATTGACTTTAAGCGGCTCAACACTCTGCTCTCGGGTATTCAGCACCAAGAA
ACGCGCAACGAATGCCTCTACTCTCCAGGACAATGGGAGCGCGGCGGGTGGTTCGTCAAGAGACACGAGCCACCA
GCCACTCCAGCCCATGAAGCCACCACGCCCTAG
Transcript >OphauG2|109
ATGGACCAGCCGTTGCCGTCGCCCTCGTCGCCGCAGCAGGATGCTGAGCCGCCGCCGCGGCCACCCCCCCAGGAC
CAGCAGCATGGTGCTACACGGCAAAGCTCCCCCAAAGCCTCTCCGTCTCCTCCACATTCTCTGGCAACAATAAAC
GGCCATTCCAGAGGCGCCGCCAGTTCGTCGTGGAGTACTGGTTCGGAGCGACAAGTCGGTCCCTCGTATGCCGCC
TCAGAAATGTCGACCGACCGAGTCTTTCCCATACGCTCCGTCGTCAGCTTAAACCCCGCTCCTGCAGGCAGGCGA
AATTCCTTGTCGGAAGATGGCCTGGTCCATGGCACAAATGACAGCGGATCGGCGTCCCTTCATCGACGTACCTCT
TCTCTGAGACTGCAGGCCACGAGGGACGAGTTTAGAAGAGCCGACACGCTGCCTCCTTTACCAACCAGCCCCTCT
CACCTGGACCACGCAGCAGCCTATGTTCGCAGAAAACGGGCCATGAGCGGGCCCTTTTCCAGCATCCAGGCAGAT
GCAGCTCGAAAGGGCACCATTGCACCTCTGCATCTTAACATCTCGGCGTCGGACCTGGAGTCTGAAGAGTCGGAA
GTTGCCCCAGACCCTGACACTGCGCGGATGAGCAACGCTTCGGCTCTATCTCGCCAACAGTCGCTGGATGAAGTG
CCTCATGTCACGACGCGCTTCACCCACGTCGAGTCTGAAAGTGGACACTCCGTCATTACAGGGCGAGACGGCGTG
CTGCAGCGCTGTGAAGACGAGCCCATCCACACGCCTGGAGCCGTACAGGGCTTTGGCACCCTGTTGGCGCTCCGC
GAGGAACAAGACGGAAGCTTTGTCGTTCGCTATGTCAGCGAAAATTCAGAAAAAATACTCGGCTACAGCCCCGGT
CATCTCTTCAAGCTCAAGAGCTTCATGCAAATTTTGACCGAGGAACAGCAAGACAACCTGCTCGACCACATCGAC
TTTATTCGCGATGAGGATGCCGATGCTTCAGCCAACGGTCCCGAAGTCCTCAGCTTGTCGATTCGTTCCCCCAAG
AAGCGCCGCAACGTCAAGCTCTGGTGCGCCATCCATATCAACCCGGCCCATCCCGAGCTCATCATCTGCGAGTTT
GAGCTCGACGACGACGTTGAGTTTCCGCTTCGCCCGCCGGATGAGCTGACGCCCAACATGCCACACGACACCCTG
CACTCGAACCCGACGCTCGAGGAGATTGAAGAGAGCACAGAAATACTCAGCAAGCCGCTGCGCATCCTTCGTAGC
GCTAGAAAGCGCAGAGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCGCAGGTTCAAGAACAGCTCGCC
TCAGCCCCCAACCTGGATGCTTTTCTCAAGGTTCTTGTCGGTATCGTCAAGGAGCTGACTGGCTTCCACCGCGTC
ATGGTGTATCAATTCGACTCGGCCTACAACGGCAAGGTGGTGACGGAACTTGTTGACACGTCGCAGACTATTGAC
TTGTACAAGGGTCTTCACTTTCCGGCATCTGACATTCCCCGGCAAGCTCGCCAGCTCTACACCATCAACAAGGTG
CGGCTTTTGTACGACCGAGACATGGAGACGGCTCGAATTGTTTGCCGCTCTCAAGAGGATCTCGAGCTCCCCTTG
GACATGACGCATGCCTATCTGAGAGCAATGTCTCCGATCCATCTTAAGTATTTGGCCAACATGGCGGTGCGATCG
TCCATGTCCATCTCCATCAATGCTTTTGATGAGCTTTGGGGGCTAATTGCCTGTCATTCTTATGGCCCCCGTGGG
ATGCGAGTCTCGTTTCCCATTCGCAAGATGTGTCGCCTTGTTGGAGACACTGCCTCTCAAAACATTGAGAGATTG
TCGTATGCCTCGAGGCTACAGGCGCGGAAACTCATCAATACTGCGCCTACGGACAAGAATCCGTCTGGATACATT
ATCGCTTCGTCGGATGATCTGTTGAAGCTGTTTGATGCTGATTTTGGTCTGCTGTCAATCAAGGGCGAGACCAAA
ATTCTGGGTGTCATGGAGCAGAGCCAGGAAGCGCTGGCCATGTTGGAGTATCTGCGGATGCGCAAGCTGACGGCC
GTCTTGGCTTCGCACGACGTTAGCGAGGACTTTCCCGACCTTGGATACCCTCCGGGCTTTCGAATCCTTGCCGGC
CTGCTCTACGTTCCGTTGAGTGTGGGAGGCAACGATTTTATAGTCTTTTTCCGCCAGGGGCAGATAAGAGAAGTC
AAGTGGGCGGGTAATCCTTATGAAAAGACGGTTCGTGAGGGGACGGCTGGCTTTTTGGAGCCGCGGTCGAGCTTC
AAGACGTGGAGCGAGTCCGTGGTTGGACAGTGTCGGGAATGGAACGAGGAGCAAATCGAGACGGCAGCTGTACTG
TGCCTGGTTTATGGCAAATTCATTGAAGTCTGGCGGCAAAAGGAGGCGGCTCTACAGAACAGCAGGCTGACGAGG
CTGCTGCTGGCCAATTCGGCGCACGAGGTGCGCACACCTCTAAATGCCATTATCAATTACCTGGAGATTGCGCTC
GAAGGGTCTCTGGATCAAGAGACGCGGGAAAACCTGGCGCGGTCTCACTCGGCGTCCAAGTCGTTGATATACGTC
ATCAATGATTTGCTGGACCTGACCAAGACGGAGGAGGGGCAGAATTTGATCAAGGACGAAATATTCGACTTGTCG
ACGTGCGTCAAGGAGGCGACGGATGCGTACCATGTGGATGCCAAGAGGAAGAACATTGAGTATCATGTTATACAG
CATCCCGGGCTTCCACAGGCTGTGCACGGAGACGGGCGGCGCGTCAGGCAAGCCATCTCCAACGTGACGGCAAAT
GCCATTGCGAACACGCAAAACGGCGCTGTCACGGTGGAAGTGTTTGTTGTCGAAGCGCGAGAGCGCCAAGCAGTG
GTGGAATTTGTGGTTGAAGACACGGGCTCTGGCATGAGCCCCAAGCAACTCGATGCTCTCTTCCGCGATCTCGAG
CAGGTCAGCAGCGAGGATAGCGAGCGCAGACTATCGTCGGATCGCAGCTCGCGGACGCTGGGCCTCGGGCTGGCC
ATGGTGGCCCGCATCGTCAGAAACATGGATGGACAGCTGCGCCTCAAGTCGGAGACGGGCCAGGGATCCAGGTTT
GTCGTCCAGCTGCCCTTCAACCTGCCCGAGGAATCGCCCCCGTCCACGTGCACTGGCAAGAGCAGCGTCGAGACG
GCGCAGAGCACGTCGTCGTCGAGTGGCGTGGTGGCGTTGGCATCGGAGCAGCTCAAGGCAGCTCCAGAAGGCGAG
ATGCTGCTGATTGATGGCAGCAGCCTTGCCGCCAACGCGACGTCGGCAGAAGGCAGTGTCAATGCTGAAAATGCA
AGCGCAGGAAGCCGGCGAAGCATGAGCAGCCTGGGCAGCCTGGGCAGCCAGCGGAGCGACGCGGAGCGCCTCATC
AATGCCATTCAAACGCCGCTTTCTCTCAACGAAAACCAGGCCGGCGGCTATTTTGCCAGTCGGCGAGACTCGCGC
AGCAGCCAGGTGCAGGCGGCCGCTAGCCTGTCCAGCTCAATGACGCTTTCGCCGAGCAAGAATCCTCTGTCGGGC
CTCAAGCTTCCTCGCTCAGAGGCGGGAGGCAGTGTTGAGGTGCGCGACTCGAGAACGCCAGTCCGGCCTGTCAAG
GTGCCAGAGACGTACGTGGATGTGCCCGACGCCTTGTTGCAATTGCCGAGCAATCAAGCTGCAGTCGCCAGTCGA
AGCAGAAGCAACACCAGCACTAGCTCCCATGGCCAACGAGTTCTGCGCACCCTCATTGCCGACGACGATCCCATC
AATCTCAAGGTGCTGCGGAAGAGGCTGGAAAAGGCTGGCCACCAAGTGCACCATGCTGTCAATGGTGAAGACTGC
GCCAGCTTGTACTGCGGAGATTCGTCGTCTTTTGATGCCATCTTGATGGACATGCAGATGCCCATTGTCGACGGT
CTCACTAGCACCAAGATGATTCGATGCATGGAGCTTTCTCCCCAACATGGAGGCCACTCTGAACTGGCCGCGGCA
AACGGCCGCATTCCCATATTTGCCGTGTCAGCCTCTCTAGTGGAGCACGATAGGCTGGTATATATCAATGCGGGA
TTCGATGGCTGGATCCTCAAGCCCATTGACTTTAAGCGGCTCAACACTCTGCTCTCGGGTATTCAGCACCAAGAA
ACGCGCAACGAATGCCTCTACTCTCCAGGACAATGGGAGCGCGGCGGGTGGTTCGTCAAGAGACACGAGCCACCA
GCCACTCCAGCCCATGAAGCCACCACGCCCTAG
Gene >OphauG2|109
ATGGACCAGCCGTTGCCGTCGCCCTCGTCGCCGCAGCAGGATGCTGAGCCGCCGCCGCGGCCACCCCCCCAGGAC
CAGCAGCATGGTGCTACACGGCAAAGCTCCCCCAAAGCCTCTCCGTCTCCTCCACATTCTCTGGCAACAATAAAC
GGCCATTCCAGAGGCGCCGCCAGTTCGTCGTGGAGTACTGGTTCGGAGCGACAAGTCGGTCCCTCGTATGCCGCC
TCAGAAATGTCGACCGACCGAGTCTTTCCCATACGCTCCGTCGTCAGCTTAAACCCCGCTCCTGCAGGCAGGCGA
AATTCCTTGTCGGAAGATGGCCTGGTCCATGGCACAAATGACAGCGGATCGGCGTCCCTTCATCGACGTACCTCT
TCTCTGAGACTGCAGGCCACGAGGGACGAGTTTAGAAGAGCCGACACGCTGCCTCCTTTACCAACCAGCCCCTCT
CACCTGGACCACGCAGCAGCCTATGTTCGCAGAAAACGGGCCATGAGCGGGCCCTTTTCCAGCATCCAGGCAGAT
GCAGCTCGAAAGGGCACCATTGCACCTCTGCATCTTAACATCTCGGCGTCGGACCTGGAGTCTGAAGAGTCGGAA
GTTGCCCCAGACCCTGACACTGCGCGGATGAGCAACGCTTCGGCTCTATCTCGCCAACAGTCGCTGGATGAAGTG
CCTCATGTCACGACGCGCTTCACCCACGTCGAGTCTGAAAGTGGACACTCCGTCATTACAGGGCGAGACGGCGTG
CTGCAGCGCTGTGAAGACGAGCCCATCCACACGCCTGGAGCCGTACAGGGCTTTGGCACCCTGTTGGCGCTCCGC
GAGGAACAAGACGGAAGCTTTGTCGTTCGCTATGTCAGCGAAAATTCAGAAAAAATACTCGGCTACAGCCCCGGT
CATCTCTTCAAGCTCAAGAGCTTCATGCAAATTTTGACCGAGGAACAGCAAGACAACCTGCTCGACCACATCGAC
TTTATTCGCGATGAGGATGCCGATGCTTCAGCCAACGGTCCCGAAGTCCTCAGCTTGTCGATTCGTTCCCCCAAG
AAGCGCCGCAACGTCAAGCTCTGGTGCGCCATCCATATCAACCCGGCCCATCCCGAGCTCATCATCTGCGAGTTT
GAGCTCGACGACGACGTTGAGTTTCCGCTTCGCCCGCCGGATGAGCTGACGCCCAACATGCCACACGACACCCTG
CACTCGAACCCGACGCTCGAGGAGATTGAAGAGAGCACAGAAATACTCAGCAAGCCGCTGCGCATCCTTCGTAGC
GCTAGAAAGCGCAGAGGCGAGCAGGGCGCCATGCAGGTCTTTGACATCATGTCGCAGGTTCAAGAACAGCTCGCC
TCAGCCCCCAACCTGGATGCTTTTCTCAAGGTTCTTGTCGGTATCGTCAAGGAGCTGACTGGCTTCCACCGCGTC
ATGGTGTATCAATTCGACTCGGCCTACAACGGCAAGGTGGTGACGGAACTTGTTGACACGTCGCAGACTATTGAC
TTGTACAAGGGTCTTCACTTTCCGGCATCTGACATTCCCCGGCAAGCTCGCCAGCTCTACACCATCAACAAGGTG
CGGCTTTTGTACGACCGAGACATGGAGACGGCTCGAATTGTTTGCCGCTCTCAAGAGGATCTCGAGCTCCCCTTG
GACATGACGCATGCCTATCTGAGAGCAATGTCTCCGATCCATCTTAAGTATTTGGCCAACATGGCGGTGCGATCG
TCCATGTCCATCTCCATCAATGCTTTTGATGAGCTTTGGGGGCTAATTGCCTGTCATTCTTATGGCCCCCGTGGG
ATGCGAGTCTCGTTTCCCATTCGCAAGATGTGTCGCCTTGTTGGAGACACTGCCTCTCAAAACATTGAGAGATTG
TCGTATGCCTCGAGGCTACAGGCGCGGAAACTCATCAATACTGCGCCTACGGACAAGAATCCGTCTGGATACATT
ATCGCTTCGTCGGATGATCTGTTGAAGCTGTTTGATGCTGATTTTGGTCTGCTGTCAATCAAGGGCGAGACCAAA
ATTCTGGGTGTCATGGAGCAGAGCCAGGAAGCGCTGGCCATGTTGGAGTATCTGCGGATGCGCAAGCTGACGGCC
GTCTTGGCTTCGCACGACGTTAGCGAGGACTTTCCCGACCTTGGATACCCTCCGGGCTTTCGAATCCTTGCCGGC
CTGCTCTACGTTCCGTTGAGTGTGGGAGGCAACGATTTTATAGTCTTTTTCCGCCAGGGGCAGATAAGAGAAGTC
AAGTGGGCGGGTAATCCTTATGAAAAGACGGTTCGTGAGGGGACGGCTGGCTTTTTGGAGCCGCGGTCGAGCTTC
AAGACGTGGAGCGAGTCCGTGGTTGGACAGTGTCGGGAATGGAACGAGGAGCAAATCGAGACGGCAGCTGTACTG
TGCCTGGTTTATGGTAAGAGCCCGAGGCGACTTGGGTGCAGAGACAAACTGATGAATGGCGTCTAGGCAAATTCA
TTGAAGTCTGGCGGCAAAAGGAGGCGGCTCTACAGAACAGCAGGCTGACGAGGCTGCTGCTGGCCAATTCGGCGC
ACGAGGTGCGCACACCTCTAAATGCCATTATCAATTACCTGGAGATTGCGCTCGAAGGGTCTCTGGATCAAGAGA
CGCGGGAAAACCTGGCGCGGTCTCACTCGGCGTCCAAGTCGTTGATATACGTCATCAATGATTTGCTGGACCTGA
CCAAGACGGAGGAGGGGCAGAATTTGATCAAGGACGAAATATTCGACTTGTCGACGTGCGTCAAGGAGGCGACGG
ATGCGTACCATGTGGATGCCAAGAGGAAGAACATTGAGTATCATGTTATACAGCATCCCGGGCTTCCACAGGCTG
TGCACGGAGACGGGCGGCGCGTCAGGCAAGCCATCTCCAACGTGACGGCAAATGCCATTGCGAACACGCAAAACG
GCGCTGTCACGGTGGAAGTGTTTGTTGTCGAAGCGCGAGAGCGCCAAGCAGTGGTGGAATTTGTGGTTGAAGACA
CGGGCTCTGGCATGAGCCCCAAGCAACTCGATGCTCTCTTCCGCGATCTCGAGCAGGTCAGCAGCGAGGATAGCG
AGCGCAGACTATCGTCGGATCGCAGCTCGCGGACGCTGGGCCTCGGGCTGGCCATGGTGGCCCGCATCGTCAGAA
ACATGGATGGACAGCTGCGCCTCAAGTCGGAGACGGGCCAGGGATCCAGGTTTGTCGTCCAGCTGCCCTTCAACC
TGCCCGAGGAATCGCCCCCGTCCACGTGCACTGGCAAGAGCAGCGTCGAGACGGCGCAGAGCACGTCGTCGTCGA
GTGGCGTGGTGGCGTTGGCATCGGAGCAGCTCAAGGCAGCTCCAGAAGGCGAGATGCTGCTGATTGATGGCAGCA
GCCTTGCCGCCAACGCGACGTCGGCAGAAGGCAGTGTCAATGCTGAAAATGCAAGCGCAGGAAGCCGGCGAAGCA
TGAGCAGCCTGGGCAGCCTGGGCAGCCAGCGGAGCGACGCGGAGCGCCTCATCAATGCCATTCAAACGCCGCTTT
CTCTCAACGAAAACCAGGCCGGCGGCTATTTTGCCAGTCGGCGAGACTCGCGCAGCAGCCAGGTGCAGGCGGCCG
CTAGCCTGTCCAGCTCAATGACGCTTTCGCCGAGCAAGAATCCTCTGTCGGGCCTCAAGCTTCCTCGCTCAGAGG
CGGGAGGCAGTGTTGAGGTGCGCGACTCGAGAACGCCAGTCCGGCCTGTCAAGGTGCCAGAGACGTACGTGGATG
TGCCCGACGCCTTGTTGCAATTGCCGAGCAATCAAGCTGCAGTCGCCAGTCGAAGCAGAAGCAACACCAGCACTA
GCTCCCATGGCCAACGAGTTCTGCGCACCCTCATTGCCGACGACGATCCCATCAATCTCAAGGTGCTGCGGAAGA
GGCTGGAAAAGGCTGGCCACCAAGTGCACCATGCTGTCAATGGTGAAGACTGCGCCAGCTTGTACTGCGGAGATT
CGTCGTCTTTTGATGCCATCTTGATGGACATGCAGGTAAGCTTGGCGAAAGCCAAGGTGCAATCATGTGCTGATG
AGCAGCACGCCCTCTAGATGCCCATTGTCGACGGTCTCACTAGCACCAAGATGATTCGATGCATGGAGCTTTCTC
CCCAACATGGAGGCCACTCTGAACTGGCCGCGGCAAACGGCCGCATTCCCATATTTGCCGTGTCAGCCTCTCTAG
TGGAGCACGATAGGCTGGTATATATCAATGCGGGATTCGATGGCTGGATCCTCAAGCCCATTGACTTTAAGCGGC
TCAACACTCTGCTCTCGGGTATTCAGCACCAAGAAACGCGCAACGAATGCCTCTACTCTCCAGGACAATGGGAGC
GCGGCGGGTGGTTCGTCAAGAGACACGAGCCACCAGCCACTCCAGCCCATGAAGCCACCACGCCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail