Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1089
Gene name
LocationContig_13:40520..43276
Strand+
Gene length (bp)2756
Transcript length (bp)2697
Coding sequence length (bp)2697
Protein length (aa) 899

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00350 Dynamin_N Dynamin family 7.5E-17 267 437
PF01926 MMR_HSR1 50S ribosome-binding GTPase 2.9E-09 266 437

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9USY7|FZO1_SCHPO Transmembrane GTPase fzo1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fzo1 PE=3 SV=1 99 840 1.0E-126
sp|P38297|FZO1_YEAST Mitofusin FZO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FZO1 PE=1 SV=1 210 891 1.0E-113
sp|Q23424|FZO1_CAEEL Transmembrane GTPase fzo-1 OS=Caenorhabditis elegans GN=fzo-1 PE=3 SV=1 246 647 3.0E-06

GO

GO Term Description Terminal node
GO:0005525 GTP binding Yes
GO:0036094 small molecule binding No
GO:1901265 nucleoside phosphate binding No
GO:0000166 nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043168 anion binding No
GO:0097367 carbohydrate derivative binding No
GO:0017076 purine nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032561 guanyl ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0019001 guanyl nucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1326
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1089 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1103
Ophiocordyceps camponoti-floridani Ophcf2|01736
Ophiocordyceps camponoti-rufipedis Ophun1|3085
Ophiocordyceps kimflemingae Ophio5|7047
Ophiocordyceps subramaniannii Hirsu2|10690

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1089
MSQDYFNGKGKAPQRPSSASGINSNAAQDMAPSSTPASLSNHTQFMTVGSGSTSEHAARLQSMLDIDSGYGGSIA
GESHNQLAPTSGSSRDRPQSGALHQMWYNSQRATLGRSINKVLELLRNLQDINTSWPAHYPSVQRTETERPCSRP
GIIHTNTTVGDSASPSSSVEPPPTLRRSMTAVEDSSAESSRAAETRVLPEPRLVSPQIAQEFSILKLDLKLGTLH
QAELVHSLEKGSIASLLDGKIRSSIKHLFSLRERIEDTSSKVLITGDLNAGKSTFCNALLRRKVLPEDQQPCTAI
FCEVLDARENAGLEEVHAVYKDATYNRSDESTYHVFLLGELDKIVVDNETYGQCKIYVKDIRSIDESLLNNGVVD
IALIDAPGLNSDTTKTTAIFARQEEIDVVVFVVSAANHFTQSAKEFIWAAAAEKAYLFIVVNGYDAIRDKQRCQK
LILDQVSGLSPRTHKESSELVHFVSSNAIPAGPSPPGGPGGSSSGSSSGGGGGDDPADDKGKGKDKEKIRDFEAL
EQSLRRFVLEKRARSKLAPARTYLLNILNDVHTLAAVNQGVAQSELERVTRQLEELEPQLETSKKARSEVGDQIE
RDIEDTCQEIYHDTRSKLNTAIAHAGEANLNVPYTGLFGVFQYADDLKEAMLSHISDAVSDCEEYARGRSVQSVN
IIKQLGILHIGNEFETLQFRPDVMFRRKRDALARQVDVPTELWDFVDWSTLLQRQEKFAGTGMALTVAGALVPRL
MGVNSWFDQALTATRVLSNGNMRQLILPGILVAAIAASIYIVQQIPNSLPPRLATKISAQLMQLDYVHANSARIS
SSVRKVLRYPADNLRVGLDKNVKDLSSRRDDTVKAKDESEQASRIFRGLVGESEVQRSMVEAVDLDSPPPGLH*
Coding >OphauG2|1089
ATGAGCCAAGATTACTTCAACGGCAAAGGCAAGGCGCCTCAACGCCCCAGCTCAGCCTCCGGCATCAACTCCAAT
GCTGCACAGGACATGGCTCCATCATCAACTCCCGCATCTCTGAGCAATCATACGCAGTTCATGACCGTCGGTTCG
GGCTCCACGTCGGAGCACGCTGCACGCTTGCAAAGCATGCTCGACATCGACTCAGGCTACGGAGGCAGCATCGCG
GGGGAGTCTCATAATCAACTTGCCCCTACTTCAGGCTCCTCTCGCGACCGACCGCAATCTGGTGCATTGCATCAA
ATGTGGTACAACTCTCAGCGCGCAACACTCGGCCGATCCATCAACAAGGTCCTTGAACTGCTGCGCAACTTGCAG
GACATCAATACGTCATGGCCAGCGCATTATCCGTCCGTACAACGGACAGAGACGGAAAGACCATGTTCGCGACCT
GGAATTATTCACACCAATACCACAGTTGGAGACTCGGCTAGCCCTTCGTCAAGCGTCGAACCTCCGCCTACCCTT
CGTCGATCTATGACAGCTGTCGAAGACTCATCGGCCGAATCGAGCCGAGCCGCCGAAACTCGCGTCTTGCCGGAG
CCAAGACTGGTATCGCCTCAAATTGCACAGGAATTCTCCATCTTGAAGTTGGATCTAAAGCTCGGGACTCTGCAT
CAAGCTGAGCTTGTACATTCGCTGGAGAAGGGGTCTATTGCCTCCCTACTGGATGGTAAAATTCGATCCAGTATC
AAGCATCTTTTTTCGCTCCGAGAGCGGATAGAAGACACCTCCAGCAAGGTTCTCATCACTGGGGATCTCAATGCT
GGTAAATCAACCTTTTGCAATGCGCTCCTGCGGCGCAAGGTGTTACCTGAAGATCAACAACCATGCACAGCCATC
TTTTGCGAAGTCTTGGATGCCAGAGAGAACGCTGGGCTTGAAGAGGTGCATGCAGTATATAAAGATGCGACGTAC
AACAGAAGCGACGAATCGACATACCACGTCTTCTTGCTGGGCGAGCTGGACAAAATTGTCGTTGACAATGAGACA
TATGGACAATGCAAGATATATGTCAAAGATATTCGGTCAATTGACGAGTCGTTACTTAACAATGGCGTCGTTGAT
ATTGCCCTGATTGACGCGCCAGGGCTTAACTCAGACACCACCAAAACAACGGCTATATTCGCAAGACAAGAAGAA
ATCGACGTCGTTGTCTTTGTTGTCTCTGCAGCAAATCACTTCACACAATCAGCTAAAGAGTTCATATGGGCTGCC
GCGGCCGAGAAGGCCTATCTTTTTATAGTCGTCAATGGCTATGACGCAATTCGGGATAAGCAGCGTTGCCAAAAG
TTGATACTAGATCAGGTTTCAGGCCTTAGTCCACGCACTCACAAAGAGTCGTCGGAGCTTGTGCACTTTGTGTCG
AGTAATGCGATCCCTGCTGGACCGTCTCCCCCTGGTGGGCCGGGAGGCAGCAGTAGTGGCAGCTCCAGCGGCGGT
GGCGGTGGTGATGACCCTGCTGATGACAAGGGTAAAGGCAAGGACAAGGAAAAAATTCGAGACTTTGAGGCACTG
GAGCAGTCATTGCGCAGGTTTGTGCTCGAGAAGCGTGCGCGATCTAAACTTGCGCCAGCGCGAACCTATCTGCTC
AACATACTCAACGATGTCCACACGCTGGCAGCGGTAAATCAGGGAGTCGCCCAATCAGAGCTGGAGCGAGTGACT
CGGCAACTCGAAGAGCTTGAGCCCCAGTTGGAGACGAGCAAGAAAGCGAGGTCGGAAGTTGGAGATCAAATCGAA
CGCGACATCGAAGACACGTGTCAAGAAATCTACCATGATACTCGCTCCAAACTAAACACAGCTATTGCCCACGCG
GGAGAGGCGAATCTAAACGTTCCCTATACCGGCCTCTTTGGGGTCTTTCAGTATGCCGACGACCTTAAAGAAGCC
ATGCTTTCTCACATTTCCGATGCCGTCAGCGATTGCGAGGAATATGCGCGCGGAAGATCAGTCCAAAGCGTCAAC
ATCATCAAGCAACTTGGCATTTTGCACATTGGCAACGAATTTGAAACGCTCCAGTTTCGCCCAGACGTCATGTTT
CGCCGCAAGAGAGATGCTCTTGCTCGCCAGGTTGATGTTCCAACCGAACTGTGGGATTTTGTCGACTGGTCGACT
CTGTTGCAACGACAAGAAAAGTTTGCGGGCACTGGCATGGCTCTTACCGTTGCTGGTGCTCTCGTCCCTCGTCTA
ATGGGTGTCAACAGCTGGTTTGACCAGGCTCTGACTGCAACGCGTGTCTTGAGCAACGGCAACATGCGCCAGCTC
ATACTGCCCGGAATCCTCGTAGCAGCTATTGCTGCATCAATATATATCGTGCAGCAAATTCCCAACTCGTTGCCC
CCGCGGTTGGCTACCAAGATATCGGCACAGCTTATGCAGCTAGACTACGTGCATGCAAACTCGGCGCGCATCTCG
TCATCGGTGCGCAAGGTGCTCCGCTACCCAGCCGATAATCTACGCGTAGGCTTGGACAAAAACGTCAAGGATTTG
TCTTCAAGGCGTGATGATACCGTCAAGGCCAAGGACGAAAGTGAACAGGCATCCAGGATTTTTCGGGGTCTTGTC
GGCGAGAGCGAAGTGCAAAGAAGCATGGTCGAGGCGGTCGACTTGGACTCGCCACCGCCAGGACTGCACTGA
Transcript >OphauG2|1089
ATGAGCCAAGATTACTTCAACGGCAAAGGCAAGGCGCCTCAACGCCCCAGCTCAGCCTCCGGCATCAACTCCAAT
GCTGCACAGGACATGGCTCCATCATCAACTCCCGCATCTCTGAGCAATCATACGCAGTTCATGACCGTCGGTTCG
GGCTCCACGTCGGAGCACGCTGCACGCTTGCAAAGCATGCTCGACATCGACTCAGGCTACGGAGGCAGCATCGCG
GGGGAGTCTCATAATCAACTTGCCCCTACTTCAGGCTCCTCTCGCGACCGACCGCAATCTGGTGCATTGCATCAA
ATGTGGTACAACTCTCAGCGCGCAACACTCGGCCGATCCATCAACAAGGTCCTTGAACTGCTGCGCAACTTGCAG
GACATCAATACGTCATGGCCAGCGCATTATCCGTCCGTACAACGGACAGAGACGGAAAGACCATGTTCGCGACCT
GGAATTATTCACACCAATACCACAGTTGGAGACTCGGCTAGCCCTTCGTCAAGCGTCGAACCTCCGCCTACCCTT
CGTCGATCTATGACAGCTGTCGAAGACTCATCGGCCGAATCGAGCCGAGCCGCCGAAACTCGCGTCTTGCCGGAG
CCAAGACTGGTATCGCCTCAAATTGCACAGGAATTCTCCATCTTGAAGTTGGATCTAAAGCTCGGGACTCTGCAT
CAAGCTGAGCTTGTACATTCGCTGGAGAAGGGGTCTATTGCCTCCCTACTGGATGGTAAAATTCGATCCAGTATC
AAGCATCTTTTTTCGCTCCGAGAGCGGATAGAAGACACCTCCAGCAAGGTTCTCATCACTGGGGATCTCAATGCT
GGTAAATCAACCTTTTGCAATGCGCTCCTGCGGCGCAAGGTGTTACCTGAAGATCAACAACCATGCACAGCCATC
TTTTGCGAAGTCTTGGATGCCAGAGAGAACGCTGGGCTTGAAGAGGTGCATGCAGTATATAAAGATGCGACGTAC
AACAGAAGCGACGAATCGACATACCACGTCTTCTTGCTGGGCGAGCTGGACAAAATTGTCGTTGACAATGAGACA
TATGGACAATGCAAGATATATGTCAAAGATATTCGGTCAATTGACGAGTCGTTACTTAACAATGGCGTCGTTGAT
ATTGCCCTGATTGACGCGCCAGGGCTTAACTCAGACACCACCAAAACAACGGCTATATTCGCAAGACAAGAAGAA
ATCGACGTCGTTGTCTTTGTTGTCTCTGCAGCAAATCACTTCACACAATCAGCTAAAGAGTTCATATGGGCTGCC
GCGGCCGAGAAGGCCTATCTTTTTATAGTCGTCAATGGCTATGACGCAATTCGGGATAAGCAGCGTTGCCAAAAG
TTGATACTAGATCAGGTTTCAGGCCTTAGTCCACGCACTCACAAAGAGTCGTCGGAGCTTGTGCACTTTGTGTCG
AGTAATGCGATCCCTGCTGGACCGTCTCCCCCTGGTGGGCCGGGAGGCAGCAGTAGTGGCAGCTCCAGCGGCGGT
GGCGGTGGTGATGACCCTGCTGATGACAAGGGTAAAGGCAAGGACAAGGAAAAAATTCGAGACTTTGAGGCACTG
GAGCAGTCATTGCGCAGGTTTGTGCTCGAGAAGCGTGCGCGATCTAAACTTGCGCCAGCGCGAACCTATCTGCTC
AACATACTCAACGATGTCCACACGCTGGCAGCGGTAAATCAGGGAGTCGCCCAATCAGAGCTGGAGCGAGTGACT
CGGCAACTCGAAGAGCTTGAGCCCCAGTTGGAGACGAGCAAGAAAGCGAGGTCGGAAGTTGGAGATCAAATCGAA
CGCGACATCGAAGACACGTGTCAAGAAATCTACCATGATACTCGCTCCAAACTAAACACAGCTATTGCCCACGCG
GGAGAGGCGAATCTAAACGTTCCCTATACCGGCCTCTTTGGGGTCTTTCAGTATGCCGACGACCTTAAAGAAGCC
ATGCTTTCTCACATTTCCGATGCCGTCAGCGATTGCGAGGAATATGCGCGCGGAAGATCAGTCCAAAGCGTCAAC
ATCATCAAGCAACTTGGCATTTTGCACATTGGCAACGAATTTGAAACGCTCCAGTTTCGCCCAGACGTCATGTTT
CGCCGCAAGAGAGATGCTCTTGCTCGCCAGGTTGATGTTCCAACCGAACTGTGGGATTTTGTCGACTGGTCGACT
CTGTTGCAACGACAAGAAAAGTTTGCGGGCACTGGCATGGCTCTTACCGTTGCTGGTGCTCTCGTCCCTCGTCTA
ATGGGTGTCAACAGCTGGTTTGACCAGGCTCTGACTGCAACGCGTGTCTTGAGCAACGGCAACATGCGCCAGCTC
ATACTGCCCGGAATCCTCGTAGCAGCTATTGCTGCATCAATATATATCGTGCAGCAAATTCCCAACTCGTTGCCC
CCGCGGTTGGCTACCAAGATATCGGCACAGCTTATGCAGCTAGACTACGTGCATGCAAACTCGGCGCGCATCTCG
TCATCGGTGCGCAAGGTGCTCCGCTACCCAGCCGATAATCTACGCGTAGGCTTGGACAAAAACGTCAAGGATTTG
TCTTCAAGGCGTGATGATACCGTCAAGGCCAAGGACGAAAGTGAACAGGCATCCAGGATTTTTCGGGGTCTTGTC
GGCGAGAGCGAAGTGCAAAGAAGCATGGTCGAGGCGGTCGACTTGGACTCGCCACCGCCAGGACTGCACTGA
Gene >OphauG2|1089
ATGAGCCAAGATTACTTCAACGGCAAAGGCAAGGCGCCTCAACGCCCCAGCTCAGCCTCCGGCATCAACTCCAAT
GCTGCACAGGACATGGCTCCATCATCAACTCCCGCATCTCTGAGCAATCATACGCAGTTCATGACCGTCGGTTCG
GGCTCCACGTCGGAGCACGCTGCACGCTTGCAAAGCATGCTCGACATCGACTCAGGCTACGGAGGCAGCATCGCG
GGGGAGTCTCATAATCAACTTGCCCCTACTTCAGGCTCCTCTCGCGACCGACCGCAATCTGGTGCATTGCATCAA
ATGTGGTACAACTCTCAGCGCGCAACACTCGGCCGATCCATCAACAAGGTCCTTGAACTGCTGCGCAACTTGCAG
GACATCAATACGTCATGGCCAGCGCATTATCCGTCCGTACAACGGACAGAGACGGAAAGACCATGTTCGCGACCT
GGAATTATTCACACCAATACCACAGTTGGAGACTCGGCTAGCCCTTCGTCAAGCGTCGAACCTCCGCCTACCCTT
CGTCGATCTATGACAGCTGTCGAAGACTCATCGGCCGAATCGAGCCGAGCCGCCGAAACTCGCGTCTTGCCGGAG
CCAAGACTGGTATCGCCTCAAATTGCACAGGAATTCTCCATCTTGAAGTTGGATCTAAAGCTCGGGACTCTGCAT
CAAGCTGAGCTTGTACATTCGCTGGAGAAGGGGTCTATTGCCTCCCTACTGGATGGTAAAATTCGATCCAGTATC
AAGCATCTTTTTTCGCTCCGAGAGCGGATAGAAGACACCTCCAGCAAGGTTCTCATCACTGGGGATCTCAATGCT
GGTAAATCAACCTTTTGCAATGCGCTCCTGCGGCGCAAGGTGTTACCTGAAGATCAACAACCATGCACAGCCATC
TTTTGCGAAGTCTTGGATGCCAGAGAGAACGCTGGGCTTGAAGAGGTGCATGCAGTATATAAAGATGCGACGTAC
AACAGAAGCGACGAATCGACATACCACGTCTTCTTGCTGGGCGAGCTGGACAAAATTGTCGTTGACAATGAGACA
TATGGACAATGCAAGATATATGTCAAAGATATTCGGTCAATTGACGAGTCGTTACTTAACAATGGCGTCGTTGAT
ATTGCCCTGATTGACGCGCCAGGGCTTAACTCAGACACCACCAAAACAACGGCTATATTCGCAAGACAAGAAGAA
ATCGACGTCGTTGTCTTTGTTGTCTCTGCAGCAAATCACTTCACACAATCAGCTAAAGAGTTCATATGGGCTGCC
GCGGCCGAGAAGGCCTATCTTTTTATAGTCGTCAATGGCTATGACGCAATTCGGGATAAGCAGCGTTGCCAAAAG
TTGATACTAGATCAGGTTTCAGGCCTTAGTCCACGCACTCACAAAGAGTCGTCGGAGCTTGTGCACTTTGTGTCG
AGTAATGCGATCCCTGCTGGACCGTCTCCCCCTGGTGGGCCGGGAGGCAGCAGTAGTGGCAGCTCCAGCGGCGGT
GGCGGTGGTGATGACCCTGCTGATGACAAGGGTAAAGGCAAGGACAAGGAAAAAATTCGAGACTTTGAGGCACTG
GAGCAGTCATTGCGCAGGTTTGTGCTCGAGAAGCGTGCGCGATCTAAACTTGCGCCAGCGCGAACCTATCTGCTC
AACATACTCAACGATGTCCACACGCTGGCAGCGGTAAATCAGGGAGTCGCCCAATCAGAGCTGGAGCGAGTGACT
CGGCAACTCGAAGAGCTTGAGCCCCAGTTGGAGACGAGCAAGAAAGCGAGGTCGGAAGTTGGAGATCAAATCGAA
CGCGACATCGAAGACACGTGTCAAGAAATCTACCATGATACTCGCTCCAAACTAAACACAGCTATTGCCCACGCG
GGAGAGGCGAATCTAAACGTTCCCTATACCGGCCTCTTTGGGGTCTTTCAGTATGCCGACGACCTTAAAGAAGCC
ATGCTTTCTCACATTTCCGATGCCGTCAGCGATTGCGAGGAATATGCGCGCGGAAGATCAGTCCAAAGCGTCAAC
ATCATCAAGCAACTTGGCATTTTGCACATTGGCAACGAATTTGAAACGCTCCAGTTTCGCCCAGACGTCATGTTT
CGCCGCAAGAGAGATGCTCTTGCTCGCCAGGTTGATGTTCCAACCGAACTGTGGGATTTTGTCGACTGGTCGACT
CTGTTGCAACGACAAGAAAAGTTTGCGGGCACTGGCATGGCTCTTACCGTTGCTGGTGCTCTCGTCCCTCGTCTA
ATGGGTGTCAACAGCTGGTTTGACCAGGCTCTGACTGCAACGCGTGTCTTGAGCAACGGCAACATGCGCCAGCTC
ATACTGCCCGGAATCCTCGTAGCAGGTAAGTCGTTGTGGCAAGAGATGTGTCTAGACTTTCTGCTTACTTATTCT
CGTGCCTAGCTATTGCTGCATCAATATATATCGTGCAGCAAATTCCCAACTCGTTGCCCCCGCGGTTGGCTACCA
AGATATCGGCACAGCTTATGCAGCTAGACTACGTGCATGCAAACTCGGCGCGCATCTCGTCATCGGTGCGCAAGG
TGCTCCGCTACCCAGCCGATAATCTACGCGTAGGCTTGGACAAAAACGTCAAGGATTTGTCTTCAAGGCGTGATG
ATACCGTCAAGGCCAAGGACGAAAGTGAACAGGCATCCAGGATTTTTCGGGGTCTTGTCGGCGAGAGCGAAGTGC
AAAGAAGCATGGTCGAGGCGGTCGACTTGGACTCGCCACCGCCAGGACTGCACTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail