Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1086
Gene name
LocationContig_13:30961..34160
Strand-
Gene length (bp)3199
Transcript length (bp)2979
Coding sequence length (bp)2979
Protein length (aa) 993

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2343
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1086 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1106
Ophiocordyceps camponoti-floridani Ophcf2|01733
Ophiocordyceps camponoti-rufipedis Ophun1|3088
Ophiocordyceps kimflemingae Ophio5|7467
Ophiocordyceps subramaniannii Hirsu2|3220

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1086
MSLNGLDDGAVGEALDTVLSEPEAWLLLNYASRDQVALLRQGKEGIAEMRSAIIAHSETSPLYGLLRHGSKRVVV
KYLPDDCSRLIRARVAVHFEAVCERFTPHDTTLEITTADHLSDSRLASACSLHSPSASVSSSTGPRRRRLTETLD
DESAVQGDMKRQSLESESPADSALLVESVKLDSLLASSPQHSKFSADSTAELPMFVGADSRPISPAKSSDADSAM
SYMYAKHKVKLAPRPSLDVNGRPQTAGNFRPVSAIPAGFKLFGKGNKKDKTRGGQKHEADVAIPEEKPVRPATSS
GLVQDGSTLVLLDPSPAKKATISPEKMRLIKAIKLREKNKKNRDHPVERINQDEQQQQQQQQKQQQQQGGIDATE
AAMEVAQPDSRPTSPVVAPSEAGDSTKPSSLSESTDGTVGAKTSEEQQQQEQQLQQQEEEEEQQQQQQEQQQEQQ
QEQQQQQQQEQQQEEEEHYPDPSASIPQQSLSTADYKPPDSEHQAPQVDDKATEQDTTPETKPETLVVDTQLPPS
VSHLLDDEHLMQELQSATLEEAKSMPVSVAFCPDNRMTRQQAPRTASNPVRAQAAGAAPLGPVRSLSSGAPGNLA
KKANIGSSISQRIKALEKLSGTAGEAMPASSMLSAPASRERPSSTFFAVKRREPSRSPSVVDRASLMRPEAPAAA
PERPGSVSSRLGMFEAGGGNKTDSVSVTAKIVRQENGDEGQLRQSPLLVNHHVAAPLQDDEQHDEQHDEQIHEQH
DDRPDAAARNRHSSSLAMVKDLIKSRGESSRSPPLQQQNNSTFASRRSISSRRSSVSLSGADAPSLADDSRWAPG
DKKLSRAGRFMRRLSTLSGSRGRNAGPGVAEAVAEEQGQQQQQRLDDAAATTPTIVSYMGDVNVQFPDNLLWKRR
NMCLDSHGFLVLGALPAAAAASSRPAHASKRYHMSEFRAPYMPDVEVQELPNSVVLDFVHGMSIQVACEDRAGQK
MVLDVLQEAHASVNGLA*
Coding >OphauG2|1086
ATGTCACTAAACGGGCTCGACGATGGCGCAGTTGGCGAGGCGCTCGACACTGTCTTATCGGAGCCTGAAGCATGG
CTTCTCCTAAATTACGCCTCGCGTGACCAGGTGGCTCTTCTGAGACAAGGCAAAGAGGGCATTGCCGAGATGCGC
AGCGCCATCATTGCGCACAGTGAAACGAGTCCCCTCTACGGCTTGCTGCGACATGGCAGCAAACGCGTCGTGGTA
AAATACCTGCCTGACGATTGCTCACGGCTCATTCGAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGA
TTTACGCCCCACGACACAACGCTTGAAATCACAACAGCAGACCACCTCAGCGACTCGAGACTTGCTTCGGCCTGT
TCCTTGCATTCGCCCTCGGCTTCCGTCTCGTCATCGACTGGGCCGCGGAGGAGGCGTCTGACAGAGACTCTTGAC
GACGAATCGGCAGTACAAGGAGACATGAAGCGCCAATCGCTTGAAAGCGAGTCGCCAGCTGATAGCGCTCTGCTT
GTTGAATCGGTCAAGCTCGACTCGCTGCTGGCCTCGTCGCCCCAACACAGCAAATTCTCTGCCGACTCAACGGCA
GAGCTGCCCATGTTTGTGGGCGCCGACAGCAGGCCCATTTCGCCGGCAAAGTCGAGCGACGCCGACTCGGCCATG
TCGTACATGTACGCCAAACACAAGGTCAAGCTGGCGCCACGGCCATCTCTCGACGTCAACGGACGGCCGCAGACG
GCGGGCAACTTCCGTCCCGTGTCTGCCATTCCCGCTGGCTTCAAGCTTTTTGGCAAGGGAAACAAGAAGGACAAG
ACTAGGGGCGGTCAAAAACACGAGGCTGACGTGGCGATTCCCGAAGAGAAGCCTGTCCGGCCAGCAACGAGCTCT
GGCCTGGTACAGGATGGCTCGACGCTGGTGCTGCTGGACCCGTCACCGGCCAAGAAGGCTACTATTTCTCCCGAA
AAGATGCGCCTCATCAAGGCCATCAAGTTGAGGGAAAAGAATAAAAAGAACAGGGACCATCCAGTGGAGCGAATC
AATCAAGATGAGCAGCAGCAGCAGCAGCAGCAGCAAAAACAACAACAACAACAAGGCGGCATCGATGCCACTGAA
GCAGCAATGGAAGTGGCACAGCCAGACTCGCGGCCCACCAGTCCAGTCGTGGCTCCTTCAGAGGCTGGCGACTCG
ACAAAGCCGTCGTCTCTGTCCGAGTCTACAGACGGGACGGTGGGAGCAAAGACGAGTGAGGAGCAGCAACAACAA
GAGCAACAACTACAACAACAAGAAGAAGAAGAAGAGCAACAACAGCAGCAACAGGAGCAGCAACAGGAGCAGCAA
CAGGAGCAGCAACAACAACAACAACAAGAGCAGCAGCAGGAGGAGGAGGAGCATTACCCCGACCCCTCAGCCAGC
ATTCCTCAACAGTCACTAAGCACCGCAGATTACAAGCCCCCCGACTCTGAGCATCAAGCGCCGCAGGTCGACGAC
AAGGCAACGGAGCAAGACACAACGCCCGAGACAAAGCCCGAGACTCTTGTTGTCGACACGCAGCTGCCACCGTCA
GTCTCACACCTCCTCGACGACGAGCATCTGATGCAAGAGCTGCAAAGCGCGACGCTCGAGGAGGCCAAGTCGATG
CCCGTGTCCGTCGCCTTTTGTCCGGATAACAGAATGACGCGTCAACAAGCCCCTCGTACCGCGTCGAACCCAGTC
AGGGCTCAGGCAGCTGGCGCGGCTCCTCTTGGCCCGGTACGCTCGCTCAGCTCTGGAGCGCCGGGCAATCTGGCC
AAAAAGGCCAACATTGGGTCAAGCATCTCGCAACGTATCAAGGCTTTGGAGAAGCTATCGGGAACGGCGGGAGAG
GCCATGCCGGCGTCGAGTATGCTGTCGGCCCCAGCATCACGCGAACGGCCGTCGTCGACTTTTTTTGCCGTCAAG
AGGCGCGAGCCATCGCGGTCGCCGTCAGTGGTGGACAGGGCCAGTTTGATGCGGCCGGAAGCTCCCGCTGCGGCT
CCCGAGAGGCCAGGCTCTGTTAGCAGTCGCCTGGGCATGTTTGAGGCGGGAGGGGGCAACAAGACGGACTCGGTC
TCGGTCACGGCCAAGATTGTTCGCCAGGAAAATGGCGACGAGGGTCAACTAAGGCAGTCGCCGCTGCTGGTCAAC
CACCACGTAGCAGCGCCCCTGCAAGACGACGAGCAGCATGACGAGCAGCATGACGAGCAGATTCACGAGCAGCAC
GACGACAGGCCCGACGCGGCCGCCCGGAACCGACACTCGTCGTCTCTGGCCATGGTCAAGGACTTGATCAAGTCG
AGAGGAGAGAGCTCGCGCTCGCCCCCTCTGCAGCAACAGAACAACAGCACCTTTGCGTCGCGCCGCTCCATCAGC
AGCAGGCGCTCCTCGGTCAGTCTGTCGGGGGCTGACGCTCCCAGCCTGGCCGACGACTCGAGATGGGCGCCCGGA
GACAAGAAGCTGTCGCGCGCGGGCCGCTTCATGCGGCGGCTGTCAACGCTGTCGGGCTCGCGCGGCAGAAACGCA
GGCCCTGGAGTGGCCGAGGCTGTGGCTGAAGAGCAAGGCCAGCAGCAGCAGCAGCGACTAGACGACGCCGCCGCC
ACGACGCCCACCATTGTCTCGTACATGGGCGATGTCAATGTGCAGTTTCCCGATAACCTGCTGTGGAAGCGCCGG
AACATGTGCCTCGACTCGCACGGCTTCCTCGTCCTCGGCGCCCTGCCCGCCGCCGCCGCCGCGAGCAGCCGCCCG
GCCCACGCATCCAAGCGCTACCACATGAGCGAGTTTCGGGCCCCGTACATGCCCGACGTTGAGGTGCAGGAGCTT
CCAAACAGCGTGGTGCTTGACTTTGTCCATGGCATGAGCATCCAGGTGGCATGCGAAGACCGCGCCGGCCAGAAG
ATGGTTCTTGATGTATTACAAGAAGCACACGCTTCGGTCAATGGCTTAGCATAG
Transcript >OphauG2|1086
ATGTCACTAAACGGGCTCGACGATGGCGCAGTTGGCGAGGCGCTCGACACTGTCTTATCGGAGCCTGAAGCATGG
CTTCTCCTAAATTACGCCTCGCGTGACCAGGTGGCTCTTCTGAGACAAGGCAAAGAGGGCATTGCCGAGATGCGC
AGCGCCATCATTGCGCACAGTGAAACGAGTCCCCTCTACGGCTTGCTGCGACATGGCAGCAAACGCGTCGTGGTA
AAATACCTGCCTGACGATTGCTCACGGCTCATTCGAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGA
TTTACGCCCCACGACACAACGCTTGAAATCACAACAGCAGACCACCTCAGCGACTCGAGACTTGCTTCGGCCTGT
TCCTTGCATTCGCCCTCGGCTTCCGTCTCGTCATCGACTGGGCCGCGGAGGAGGCGTCTGACAGAGACTCTTGAC
GACGAATCGGCAGTACAAGGAGACATGAAGCGCCAATCGCTTGAAAGCGAGTCGCCAGCTGATAGCGCTCTGCTT
GTTGAATCGGTCAAGCTCGACTCGCTGCTGGCCTCGTCGCCCCAACACAGCAAATTCTCTGCCGACTCAACGGCA
GAGCTGCCCATGTTTGTGGGCGCCGACAGCAGGCCCATTTCGCCGGCAAAGTCGAGCGACGCCGACTCGGCCATG
TCGTACATGTACGCCAAACACAAGGTCAAGCTGGCGCCACGGCCATCTCTCGACGTCAACGGACGGCCGCAGACG
GCGGGCAACTTCCGTCCCGTGTCTGCCATTCCCGCTGGCTTCAAGCTTTTTGGCAAGGGAAACAAGAAGGACAAG
ACTAGGGGCGGTCAAAAACACGAGGCTGACGTGGCGATTCCCGAAGAGAAGCCTGTCCGGCCAGCAACGAGCTCT
GGCCTGGTACAGGATGGCTCGACGCTGGTGCTGCTGGACCCGTCACCGGCCAAGAAGGCTACTATTTCTCCCGAA
AAGATGCGCCTCATCAAGGCCATCAAGTTGAGGGAAAAGAATAAAAAGAACAGGGACCATCCAGTGGAGCGAATC
AATCAAGATGAGCAGCAGCAGCAGCAGCAGCAGCAAAAACAACAACAACAACAAGGCGGCATCGATGCCACTGAA
GCAGCAATGGAAGTGGCACAGCCAGACTCGCGGCCCACCAGTCCAGTCGTGGCTCCTTCAGAGGCTGGCGACTCG
ACAAAGCCGTCGTCTCTGTCCGAGTCTACAGACGGGACGGTGGGAGCAAAGACGAGTGAGGAGCAGCAACAACAA
GAGCAACAACTACAACAACAAGAAGAAGAAGAAGAGCAACAACAGCAGCAACAGGAGCAGCAACAGGAGCAGCAA
CAGGAGCAGCAACAACAACAACAACAAGAGCAGCAGCAGGAGGAGGAGGAGCATTACCCCGACCCCTCAGCCAGC
ATTCCTCAACAGTCACTAAGCACCGCAGATTACAAGCCCCCCGACTCTGAGCATCAAGCGCCGCAGGTCGACGAC
AAGGCAACGGAGCAAGACACAACGCCCGAGACAAAGCCCGAGACTCTTGTTGTCGACACGCAGCTGCCACCGTCA
GTCTCACACCTCCTCGACGACGAGCATCTGATGCAAGAGCTGCAAAGCGCGACGCTCGAGGAGGCCAAGTCGATG
CCCGTGTCCGTCGCCTTTTGTCCGGATAACAGAATGACGCGTCAACAAGCCCCTCGTACCGCGTCGAACCCAGTC
AGGGCTCAGGCAGCTGGCGCGGCTCCTCTTGGCCCGGTACGCTCGCTCAGCTCTGGAGCGCCGGGCAATCTGGCC
AAAAAGGCCAACATTGGGTCAAGCATCTCGCAACGTATCAAGGCTTTGGAGAAGCTATCGGGAACGGCGGGAGAG
GCCATGCCGGCGTCGAGTATGCTGTCGGCCCCAGCATCACGCGAACGGCCGTCGTCGACTTTTTTTGCCGTCAAG
AGGCGCGAGCCATCGCGGTCGCCGTCAGTGGTGGACAGGGCCAGTTTGATGCGGCCGGAAGCTCCCGCTGCGGCT
CCCGAGAGGCCAGGCTCTGTTAGCAGTCGCCTGGGCATGTTTGAGGCGGGAGGGGGCAACAAGACGGACTCGGTC
TCGGTCACGGCCAAGATTGTTCGCCAGGAAAATGGCGACGAGGGTCAACTAAGGCAGTCGCCGCTGCTGGTCAAC
CACCACGTAGCAGCGCCCCTGCAAGACGACGAGCAGCATGACGAGCAGCATGACGAGCAGATTCACGAGCAGCAC
GACGACAGGCCCGACGCGGCCGCCCGGAACCGACACTCGTCGTCTCTGGCCATGGTCAAGGACTTGATCAAGTCG
AGAGGAGAGAGCTCGCGCTCGCCCCCTCTGCAGCAACAGAACAACAGCACCTTTGCGTCGCGCCGCTCCATCAGC
AGCAGGCGCTCCTCGGTCAGTCTGTCGGGGGCTGACGCTCCCAGCCTGGCCGACGACTCGAGATGGGCGCCCGGA
GACAAGAAGCTGTCGCGCGCGGGCCGCTTCATGCGGCGGCTGTCAACGCTGTCGGGCTCGCGCGGCAGAAACGCA
GGCCCTGGAGTGGCCGAGGCTGTGGCTGAAGAGCAAGGCCAGCAGCAGCAGCAGCGACTAGACGACGCCGCCGCC
ACGACGCCCACCATTGTCTCGTACATGGGCGATGTCAATGTGCAGTTTCCCGATAACCTGCTGTGGAAGCGCCGG
AACATGTGCCTCGACTCGCACGGCTTCCTCGTCCTCGGCGCCCTGCCCGCCGCCGCCGCCGCGAGCAGCCGCCCG
GCCCACGCATCCAAGCGCTACCACATGAGCGAGTTTCGGGCCCCGTACATGCCCGACGTTGAGGTGCAGGAGCTT
CCAAACAGCGTGGTGCTTGACTTTGTCCATGGCATGAGCATCCAGGTGGCATGCGAAGACCGCGCCGGCCAGAAG
ATGGTTCTTGATGTATTACAAGAAGCACACGCTTCGGTCAATGGCTTAGCATAG
Gene >OphauG2|1086
ATGTCACTAAACGGGCTCGACGATGGCGCAGTTGGCGAGGCGCTCGACACTGTCTTATCGGAGCCTGAAGCATGG
TATGTGAGAATGTGTCGGCTGGCAGAATACGTGGTTGATGGCATGATGCGACAGGCTTCTCCTAAATTACGCCTC
GCGTGACCAGGTGGCTCTTCTGAGACAAGGCAAAGAGGGCATTGCCGAGATGCGCAGCGCCATCATTGCGCACAG
TGAAACGAGTCCCCTCTACGGCTTGCTGCGACATGGCAGCAAACGCGTCGTGGTAAAATACCTGCCTGACGATTG
CTCACGGCTCATTCGAGGTTGGTGCCTGGCTGGTAGAGGCGATTTGGACAGACGATTGACAGATTTACCTGGTGA
CAGCTCGAGTGGCTGTTCATTTCGAAGCCGTGTGCGAACGATTTACGCCCCACGACACAACGCTTGAAATCACAA
CAGCAGACCACCTCAGCGACTCGAGACTTGCTTCGGCCTGTTCCTTGCATTCGCCCTCGGCTTCCGTCTCGTCAT
CGACTGGGCCGCGGAGGAGGCGTCTGACAGAGACTCTTGACGACGAATCGGCAGTACAAGGAGACATGAAGCGCC
AATCGCTTGAAAGCGAGTCGCCAGCTGATAGCGCTCTGCTTGTTGAATCGGTCAAGCTCGACTCGCTGCTGGCCT
CGTCGCCCCAACACAGCAAATTCTCTGCCGACTCAACGGCAGAGCTGCCCATGTTTGTGGGCGCCGACAGCAGGC
CCATTTCGCCGGCAAAGTCGAGCGACGCCGACTCGGCCATGTCGTACATGTACGCCAAACACAAGGTCAAGCTGG
CGCCACGGCCATCTCTCGACGTCAACGGACGGCCGCAGACGGCGGGCAACTTCCGTCCCGTGTCTGCCATTCCCG
CTGGCTTCAAGCTTTTTGGCAAGGGAAACAAGAAGGACAAGACTAGGGGCGGTCAAAAACACGAGGCTGACGTGG
CGATTCCCGAAGAGAAGCCTGTCCGGCCAGCAACGAGCTCTGGCCTGGTACAGGATGGCTCGACGCTGGTGCTGC
TGGACCCGTCACCGGCCAAGAAGGCTACTATTTCTCCCGAAAAGATGCGCCTCATCAAGGCCATCAAGTTGAGGG
AAAAGAATAAAAAGAACAGGGACCATCCAGTGGAGCGAATCAATCAAGATGAGCAGCAGCAGCAGCAGCAGCAGC
AAAAACAACAACAACAACAAGGCGGCATCGATGCCACTGAAGCAGCAATGGAAGTGGCACAGCCAGACTCGCGGC
CCACCAGTCCAGTCGTGGCTCCTTCAGAGGCTGGCGACTCGACAAAGCCGTCGTCTCTGTCCGAGTCTACAGACG
GGACGGTGGGAGCAAAGACGAGTGAGGAGCAGCAACAACAAGAGCAACAACTACAACAACAAGAAGAAGAAGAAG
AGCAACAACAGCAGCAACAGGAGCAGCAACAGGAGCAGCAACAGGAGCAGCAACAACAACAACAACAAGAGCAGC
AGCAGGAGGAGGAGGAGCATTACCCCGACCCCTCAGCCAGCATTCCTCAACAGTCACTAAGCACCGCAGATTACA
AGCCCCCCGACTCTGAGCATCAAGCGCCGCAGGTCGACGACAAGGCAACGGAGCAAGACACAACGCCCGAGACAA
AGCCCGAGACTCTTGTTGTCGACACGCAGCTGCCACCGTCAGTCTCACACCTCCTCGACGACGAGCATCTGATGC
AAGAGCTGCAAAGCGCGACGCTCGAGGAGGCCAAGTCGATGCCCGTGTCCGTCGCCTTTTGTCCGGATAACAGAA
TGACGCGTCAACAAGCCCCTCGTACCGCGTCGAACCCAGTCAGGGCTCAGGCAGCTGGCGCGGCTCCTCTTGGCC
CGGTACGCTCGCTCAGCTCTGGAGCGCCGGGCAATCTGGCCAAAAAGGCCAACATTGGGTCAAGCATCTCGCAAC
GTATCAAGGCTTTGGAGAAGCTATCGGGAACGGCGGGAGAGGCCATGCCGGCGTCGAGTATGCTGTCGGCCCCAG
CATCACGCGAACGGCCGTCGTCGACTTTTTTTGCCGTCAAGAGGCGCGAGCCATCGCGGTCGCCGTCAGTGGTGG
ACAGGGCCAGTTTGATGCGGCCGGAAGCTCCCGCTGCGGCTCCCGAGAGGCCAGGCTCTGTTAGCAGTCGCCTGG
GCATGTTTGAGGCGGGAGGGGGCAACAAGACGGACTCGGTCTCGGTCACGGCCAAGATTGTTCGCCAGGAAAATG
GCGACGAGGGTCAACTAAGGCAGTCGCCGCTGCTGGTCAACCACCACGTAGCAGCGCCCCTGCAAGACGACGAGC
AGCATGACGAGCAGCATGACGAGCAGATTCACGAGCAGCACGACGACAGGCCCGACGCGGCCGCCCGGAACCGAC
ACTCGTCGTCTCTGGCCATGGTCAAGGACTTGATCAAGTCGAGAGGAGAGAGCTCGCGCTCGCCCCCTCTGCAGC
AACAGAACAACAGCACCTTTGCGTCGCGCCGCTCCATCAGCAGCAGGCGCTCCTCGGTCAGTCTGTCGGGGGCTG
ACGCTCCCAGCCTGGCCGACGACTCGAGATGGGCGCCCGGAGACAAGAAGCTGTCGCGCGCGGGCCGCTTCATGC
GGCGGCTGTCAACGCTGTCGGGCTCGCGCGGCAGAAACGCAGGCCCTGGAGTGGCCGAGGCTGTGGCTGAAGAGC
AAGGCCAGCAGCAGCAGCAGCGACTAGACGACGCCGCCGCCACGACGCCCACCATTGTCTCGTACATGGGCGATG
TCAATGTGCAGTTTCCCGATAACCTGCTGTGGAAGCGCCGGAACATGTGCCTCGACTCGCACGGCTTCCTCGTCC
TCGGCGCCCTGCCCGCCGCCGCCGCCGCGAGCAGCCGCCCGGCCCACGCATCCAAGCGCTACCACATGAGCGAGT
TTCGGGCCCCGTACATGCCCGACGTTGAGGTGCAGGAGCTTCCAAACAGCGTGGTGCTTGACTTTGTCCATGGCA
TGAGCATCCAGGTGGCATGCGAAGACCGCGCCGGCCAGAAGATGGTTCTTGATGGTATGTTTTTTTCTCTCTTTT
TTTTCCCTCTTTCTTTTTTCTTTTTTTTTTCTTCTCGTTTTTATCGCCAAGAGTTGCGAGACTGACGGTTTTATT
TTGCTTAGTATTACAAGAAGCACACGCTTCGGTCAATGGCTTAGCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail