Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1081
Gene name
LocationContig_13:14054..15029
Strand+
Gene length (bp)975
Transcript length (bp)918
Coding sequence length (bp)918
Protein length (aa) 306

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02114 Phosducin Phosducin 4.2E-13 82 293

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q13371|PHLP_HUMAN Phosducin-like protein OS=Homo sapiens GN=PDCL PE=1 SV=3 83 286 2.0E-12
sp|Q2HJA9|PHLP_BOVIN Phosducin-like protein OS=Bos taurus GN=PDCL PE=2 SV=1 83 278 2.0E-11
sp|Q63737|PHLP_RAT Phosducin-like protein OS=Rattus norvegicus GN=Pdcl PE=1 SV=1 83 278 2.0E-10
sp|Q9DBX2|PHLP_MOUSE Phosducin-like protein OS=Mus musculus GN=Pdcl PE=1 SV=1 38 278 3.0E-10
sp|P19632|PHOS_BOVIN Phosducin OS=Bos taurus GN=PDC PE=1 SV=2 191 305 1.0E-07
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q13371|PHLP_HUMAN Phosducin-like protein OS=Homo sapiens GN=PDCL PE=1 SV=3 83 286 2.0E-12
sp|Q2HJA9|PHLP_BOVIN Phosducin-like protein OS=Bos taurus GN=PDCL PE=2 SV=1 83 278 2.0E-11
sp|Q63737|PHLP_RAT Phosducin-like protein OS=Rattus norvegicus GN=Pdcl PE=1 SV=1 83 278 2.0E-10
sp|Q9DBX2|PHLP_MOUSE Phosducin-like protein OS=Mus musculus GN=Pdcl PE=1 SV=1 38 278 3.0E-10
sp|P19632|PHOS_BOVIN Phosducin OS=Bos taurus GN=PDC PE=1 SV=2 191 305 1.0E-07
sp|Q9XS39|PHOS_HORSE Phosducin OS=Equus caballus GN=PDC PE=2 SV=1 83 287 2.0E-06
sp|O77560|PHOS_CANLF Phosducin OS=Canis lupus familiaris GN=PDC PE=1 SV=2 191 287 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1081
MATTAQQEFNHLVAANTCCHRDSQRRLDDKDKDGDNLTSDNDSDDQEAAYHRAQIDAAMRSTPGDSTPELKLPPS
SFDNGRATGVKGVIADARAFQTARRSRWRDRARSARRSIFGLGGTLNNGSRSESETDDEACGSVSPHGDPALASS
NQDSDEEAFMHQWREARRRELESEESRPVRSRRTSPSVRTYGFLDEVDALGYLDAIEKVTRETKVVVFVYDDACD
VSATLESALIPLVKQHPTIHFVKVHFDEIEFDPAAVPSILAYQNQGDLMANLTGLIELMPDEAHYTQDSLSRLLR
KHNVL*
Coding >OphauG2|1081
ATGGCGACGACGGCCCAGCAGGAATTCAACCACCTTGTTGCCGCAAACACTTGCTGCCATCGCGACTCTCAAAGA
CGGCTCGACGACAAGGACAAGGACGGCGACAACTTGACCTCCGACAACGACTCTGACGATCAAGAAGCCGCCTAC
CACAGGGCGCAGATTGACGCCGCCATGCGCAGTACGCCCGGCGACTCGACCCCGGAACTCAAGCTTCCACCATCT
TCCTTTGACAACGGCCGGGCTACCGGCGTCAAGGGCGTCATTGCCGATGCCCGAGCCTTTCAGACGGCTCGCCGC
AGCCGATGGAGGGACCGGGCACGCTCGGCGCGGCGCAGCATCTTTGGGCTTGGAGGAACGCTCAACAACGGCTCC
CGCAGCGAAAGCGAGACGGACGATGAGGCCTGTGGCAGCGTCTCGCCCCACGGTGACCCAGCGCTGGCCTCTTCA
AATCAAGACTCGGACGAGGAGGCTTTTATGCACCAATGGCGCGAGGCGAGGCGGCGCGAACTCGAGAGCGAGGAA
AGCCGCCCTGTGCGCAGCCGCAGAACGAGCCCAAGTGTGCGTACATATGGCTTCCTCGACGAAGTGGACGCTCTC
GGGTACCTGGATGCCATTGAAAAGGTGACGAGAGAGACCAAGGTTGTCGTCTTTGTCTACGATGATGCCTGTGAC
GTCTCGGCAACGCTCGAATCCGCCTTGATTCCCCTGGTGAAGCAGCACCCCACGATTCACTTTGTCAAGGTGCAC
TTTGACGAGATTGAATTCGACCCGGCTGCCGTGCCATCCATCCTTGCCTACCAAAACCAGGGTGACTTGATGGCA
AACCTGACGGGGCTCATTGAGCTGATGCCTGACGAGGCACATTACACGCAAGACTCGCTTAGCCGGCTACTGCGC
AAGCACAATGTTCTCTAG
Transcript >OphauG2|1081
ATGGCGACGACGGCCCAGCAGGAATTCAACCACCTTGTTGCCGCAAACACTTGCTGCCATCGCGACTCTCAAAGA
CGGCTCGACGACAAGGACAAGGACGGCGACAACTTGACCTCCGACAACGACTCTGACGATCAAGAAGCCGCCTAC
CACAGGGCGCAGATTGACGCCGCCATGCGCAGTACGCCCGGCGACTCGACCCCGGAACTCAAGCTTCCACCATCT
TCCTTTGACAACGGCCGGGCTACCGGCGTCAAGGGCGTCATTGCCGATGCCCGAGCCTTTCAGACGGCTCGCCGC
AGCCGATGGAGGGACCGGGCACGCTCGGCGCGGCGCAGCATCTTTGGGCTTGGAGGAACGCTCAACAACGGCTCC
CGCAGCGAAAGCGAGACGGACGATGAGGCCTGTGGCAGCGTCTCGCCCCACGGTGACCCAGCGCTGGCCTCTTCA
AATCAAGACTCGGACGAGGAGGCTTTTATGCACCAATGGCGCGAGGCGAGGCGGCGCGAACTCGAGAGCGAGGAA
AGCCGCCCTGTGCGCAGCCGCAGAACGAGCCCAAGTGTGCGTACATATGGCTTCCTCGACGAAGTGGACGCTCTC
GGGTACCTGGATGCCATTGAAAAGGTGACGAGAGAGACCAAGGTTGTCGTCTTTGTCTACGATGATGCCTGTGAC
GTCTCGGCAACGCTCGAATCCGCCTTGATTCCCCTGGTGAAGCAGCACCCCACGATTCACTTTGTCAAGGTGCAC
TTTGACGAGATTGAATTCGACCCGGCTGCCGTGCCATCCATCCTTGCCTACCAAAACCAGGGTGACTTGATGGCA
AACCTGACGGGGCTCATTGAGCTGATGCCTGACGAGGCACATTACACGCAAGACTCGCTTAGCCGGCTACTGCGC
AAGCACAATGTTCTCTAG
Gene >OphauG2|1081
ATGGCGACGACGGCCCAGCAGGAATTCAACCACCTTGTTGCCGCAAACACTTGCTGCCATCGCGACTCTCAAAGA
CGGCTCGACGACAAGGACAAGGACGGCGACAACTTGACCTCCGACAACGACTCTGACGATCAAGAAGCCGCCTAC
CACAGGGCGCAGATTGACGCCGCCATGCGCAGTACGCCCGGCGACTCGACCCCGGAACTCAAGCTTCCACCATCT
TCCTTTGACAACGGCCGGGCTACCGGCGTCAAGGGCGTCATTGCCGATGCCCGAGCCTTTCAGACGGCTCGCCGC
AGCCGATGGAGGGACCGGGCACGCTCGGCGCGGCGCAGCATCTTTGGGCTTGGAGGAACGCTCAACAACGGCTCC
CGCAGCGAAAGCGAGACGGACGATGAGGCCTGTGGCAGCGTCTCGCCCCACGGTGACCCAGCGCTGGCCTCTTCA
AATCAAGACTCGGACGAGGAGGCTTTTATGCACCAATGGCGCGAGGCGAGGCGGCGCGAACTCGAGAGCGAGGAA
AGCCGCCCTGTGCGCAGCCGCAGAACGAGCCCAAGTGTGCGTACATATGGCTTCCTCGACGAAGTGGACGCTCTC
GGGTACCTGGATGCCATTGAAAAGGTGACGAGAGAGACCAAGGTTGTCGTCTTTGTCTACGATGATGCCGTAAGT
GGCCAAGCAAGCCGTCATGCTGCGAGTACACCAATGCTGACCAAGGAACAGTGTGACGTCTCGGCAACGCTCGAA
TCCGCCTTGATTCCCCTGGTGAAGCAGCACCCCACGATTCACTTTGTCAAGGTGCACTTTGACGAGATTGAATTC
GACCCGGCTGCCGTGCCATCCATCCTTGCCTACCAAAACCAGGGTGACTTGATGGCAAACCTGACGGGGCTCATT
GAGCTGATGCCTGACGAGGCACATTACACGCAAGACTCGCTTAGCCGGCTACTGCGCAAGCACAATGTTCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail