Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|107
Gene name
LocationContig_1008:1998..5423
Strand+
Gene length (bp)3425
Transcript length (bp)3372
Coding sequence length (bp)3372
Protein length (aa) 1124

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 9.9E-09 69 136
PF00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) 1.7E-23 225 798
PF09334 tRNA-synt_1g tRNA synthetases class I (M) 8.2E-09 719 801
PF08264 Anticodon_1 Anticodon-binding domain of tRNA ligase 1.6E-10 840 960
PF01406 tRNA-synt_1e tRNA synthetases class I (C) catalytic domain 4.6E-07 712 788

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1123 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 6 1123 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1123 0.0E+00
sp|Q5R614|SYLC_PONAB Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=LARS PE=2 SV=1 23 1120 0.0E+00
sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 23 1120 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P10857|SYLC_NEUCR Leucine--tRNA ligase, cytoplasmic OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=leu-6 PE=3 SV=2 1 1123 0.0E+00
sp|Q10490|SYLC_SCHPO Putative leucine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=lrs1 PE=1 SV=1 6 1123 0.0E+00
sp|P26637|SYLC_YEAST Leucine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC60 PE=1 SV=1 24 1123 0.0E+00
sp|Q5R614|SYLC_PONAB Leucine--tRNA ligase, cytoplasmic OS=Pongo abelii GN=LARS PE=2 SV=1 23 1120 0.0E+00
sp|Q9P2J5|SYLC_HUMAN Leucine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=LARS PE=1 SV=2 23 1120 0.0E+00
sp|Q8BMJ2|SYLC_MOUSE Leucine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Lars PE=1 SV=2 25 1117 0.0E+00
sp|Q09996|SYLC_CAEEL Leucine--tRNA ligase OS=Caenorhabditis elegans GN=lrs-1 PE=3 SV=2 33 1120 0.0E+00
sp|F4I116|SYLC_ARATH Leucine--tRNA ligase, cytoplasmic OS=Arabidopsis thaliana GN=At1g09620 PE=1 SV=1 23 1120 0.0E+00
sp|Q54N83|SYLC_DICDI Leucine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=leuS PE=3 SV=1 27 1120 0.0E+00
sp|Q9YD97|SYL_AERPE Leucine--tRNA ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=leuS PE=3 SV=1 31 924 5.0E-148
sp|O30250|SYL_ARCFU Leucine--tRNA ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=leuS PE=3 SV=1 36 1063 5.0E-136
sp|Q8NKR7|SYL_THEKO Leucine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=leuS PE=3 SV=2 35 1091 2.0E-128
sp|A3DKS1|SYL_STAMF Leucine--tRNA ligase OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=leuS PE=3 SV=1 28 1120 6.0E-127
sp|Q8U2E6|SYL_PYRFU Leucine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=leuS PE=3 SV=1 35 1091 7.0E-126
sp|B6YST9|SYL_THEON Leucine--tRNA ligase OS=Thermococcus onnurineus (strain NA1) GN=leuS PE=3 SV=1 35 1091 3.0E-125
sp|Q8TVM4|SYL_METKA Leucine--tRNA ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=leuS PE=3 SV=1 37 933 3.0E-124
sp|Q8TQD3|SYL_METAC Leucine--tRNA ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=leuS PE=3 SV=1 36 956 1.0E-117
sp|Q8Q054|SYL_METMA Leucine--tRNA ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=leuS PE=3 SV=2 36 956 2.0E-117
sp|Q58050|SYL_METJA Leucine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=leuS PE=3 SV=2 36 1095 5.0E-117
sp|A0B7B7|SYL_METTP Leucine--tRNA ligase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=leuS PE=3 SV=1 36 1040 9.0E-117
sp|Q12WA2|SYL_METBU Leucine--tRNA ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=leuS PE=3 SV=1 36 917 6.0E-116
sp|Q46AW0|SYL_METBF Leucine--tRNA ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=leuS PE=3 SV=1 36 933 3.0E-115
sp|A6USJ5|SYL_METVS Leucine--tRNA ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=leuS PE=3 SV=1 33 958 3.0E-114
sp|Q6LZD2|SYL_METMP Leucine--tRNA ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=leuS PE=3 SV=1 33 958 2.0E-113
sp|Q4J8J7|SYL2_SULAC Leucine--tRNA ligase 2 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS2 PE=3 SV=2 76 1121 2.0E-113
sp|Q970Z6|SYL2_SULTO Leucine--tRNA ligase 2 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS2 PE=3 SV=2 33 920 2.0E-113
sp|A4FYA3|SYL_METM5 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=leuS PE=3 SV=1 33 958 1.0E-112
sp|O27552|SYL_METTH Leucine--tRNA ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=leuS PE=1 SV=1 36 1042 2.0E-111
sp|A6VK04|SYL_METM7 Leucine--tRNA ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=leuS PE=3 SV=1 33 962 2.0E-111
sp|O58698|SYL_PYRHO Leucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuS PE=1 SV=1 201 1091 6.0E-111
sp|Q8ZXT6|SYL_PYRAE Leucine--tRNA ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=leuS PE=3 SV=1 27 946 6.0E-111
sp|Q9V0B9|SYL_PYRAB Leucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuS PE=3 SV=1 201 1091 1.0E-109
sp|A4YI28|SYL2_METS5 Leucine--tRNA ligase 2 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS2 PE=3 SV=1 28 917 1.0E-109
sp|A6UTK3|SYL_META3 Leucine--tRNA ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=leuS PE=3 SV=1 33 952 4.0E-109
sp|B1YAS9|SYL_PYRNV Leucine--tRNA ligase OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=leuS PE=3 SV=1 33 946 1.0E-106
sp|A4WHK6|SYL_PYRAR Leucine--tRNA ligase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=leuS PE=3 SV=1 33 946 3.0E-105
sp|A8A8T2|SYL_IGNH4 Leucine--tRNA ligase OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=leuS PE=3 SV=1 38 986 6.0E-105
sp|A1RTX9|SYL_PYRIL Leucine--tRNA ligase OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=leuS PE=3 SV=1 33 1091 3.0E-104
sp|O33768|SYL2_SULSO Leucine--tRNA ligase 2 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS2 PE=3 SV=2 36 1009 4.0E-103
sp|A3MU00|SYL_PYRCJ Leucine--tRNA ligase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=leuS PE=3 SV=1 33 962 9.0E-101
sp|Q974N4|SYL1_SULTO Leucine--tRNA ligase 1 OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=leuS1 PE=3 SV=1 39 990 5.0E-98
sp|A4YE96|SYL1_METS5 Leucine--tRNA ligase 1 OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=leuS1 PE=3 SV=1 36 1094 7.0E-97
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 492 872 1.0E-81
sp|P58176|SYL1_SULSO Leucine--tRNA ligase 1 OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=leuS1 PE=3 SV=1 31 1046 2.0E-81
sp|Q9HK31|SYL_THEAC Leucine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=leuS PE=3 SV=1 34 840 3.0E-81
sp|Q4JBP0|SYL1_SULAC Leucine--tRNA ligase 1 OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=leuS1 PE=3 SV=1 31 966 4.0E-81
sp|Q97AN8|SYL_THEVO Leucine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=leuS PE=3 SV=1 26 915 4.0E-80
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 523 1121 6.0E-77
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 390 799 3.0E-71
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 547 815 7.0E-67
sp|C4V8L1|SYLC_NOSCE Probable leucine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100842 PE=3 SV=1 75 396 5.0E-51
sp|Q8SRS8|SYLC_ENCCU Probable leucine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0280 PE=3 SV=1 76 385 7.0E-49
sp|B7XHP6|SYLC_ENTBH Probable leucine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21702 PE=3 SV=1 68 296 2.0E-43
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 192 365 6.0E-16
sp|Q9V0B9|SYL_PYRAB Leucine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=leuS PE=3 SV=1 35 137 2.0E-12
sp|O58698|SYL_PYRHO Leucine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=leuS PE=1 SV=1 35 137 5.0E-12
sp|P61760|SYL_NANEQ Leucine--tRNA ligase OS=Nanoarchaeum equitans (strain Kin4-M) GN=leuS PE=3 SV=1 76 192 1.0E-10
sp|Q5HPZ9|SYI_STAEQ Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ileS PE=3 SV=1 67 1029 2.0E-10
sp|Q846V6|SYI_STAEP Isoleucine--tRNA ligase OS=Staphylococcus epidermidis GN=ileS PE=3 SV=1 67 973 2.0E-10
sp|A3DEU0|SYL_CLOTH Leucine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=leuS PE=3 SV=1 704 933 5.0E-10
sp|Q9HMG9|SYV_HALSA Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=valS PE=3 SV=1 707 946 6.0E-10
sp|B0R841|SYV_HALS3 Valine--tRNA ligase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=valS PE=3 SV=1 707 946 6.0E-10
sp|Q8CSX1|SYI_STAES Isoleucine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ileS PE=3 SV=1 67 1029 6.0E-10
sp|B8HM05|SYL_CYAP4 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=leuS PE=3 SV=1 28 134 2.0E-09
sp|Q114V5|SYL_TRIEI Leucine--tRNA ligase OS=Trichodesmium erythraeum (strain IMS101) GN=leuS PE=3 SV=1 34 132 3.0E-08
sp|Q1AR71|SYL_RUBXD Leucine--tRNA ligase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=leuS PE=3 SV=1 35 134 4.0E-08
sp|Q3IUE5|SYV_NATPD Valine--tRNA ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=valS PE=3 SV=1 708 980 4.0E-08
sp|B0C1R1|SYL_ACAM1 Leucine--tRNA ligase OS=Acaryochloris marina (strain MBIC 11017) GN=leuS PE=3 SV=1 28 132 5.0E-08
sp|B2A6C2|SYL_NATTJ Leucine--tRNA ligase OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=leuS PE=3 SV=1 704 933 5.0E-08
sp|Q9RSF0|SYL_DEIRA Leucine--tRNA ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=leuS PE=3 SV=2 35 134 6.0E-08
sp|P73274|SYL_SYNY3 Leucine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=leuS PE=3 SV=1 36 132 6.0E-08
sp|A6TQK3|SYL_ALKMQ Leucine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=leuS PE=3 SV=1 751 934 8.0E-08
sp|B7KCI7|SYL_CYAP7 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 7424) GN=leuS PE=3 SV=1 35 132 1.0E-07
sp|Q1J0W5|SYL_DEIGD Leucine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=leuS PE=3 SV=1 35 134 1.0E-07
sp|Q24SP5|SYL_DESHY Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=leuS PE=3 SV=1 749 935 2.0E-07
sp|B8FUR3|SYL_DESHD Leucine--tRNA ligase OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=leuS PE=3 SV=1 749 935 2.0E-07
sp|Q8YS09|SYL_NOSS1 Leucine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=leuS PE=3 SV=1 35 150 2.0E-07
sp|C3PLG3|SYV_RICAE Valine--tRNA ligase OS=Rickettsia africae (strain ESF-5) GN=valS PE=3 SV=1 37 149 2.0E-07
sp|C4K2L1|SYV_RICPU Valine--tRNA ligase OS=Rickettsia peacockii (strain Rustic) GN=valS PE=3 SV=1 37 149 2.0E-07
sp|Q92GR9|SYV_RICCN Valine--tRNA ligase OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=valS PE=3 SV=1 37 149 2.0E-07
sp|A2BR45|SYL_PROMS Leucine--tRNA ligase OS=Prochlorococcus marinus (strain AS9601) GN=leuS PE=3 SV=1 36 132 2.0E-07
sp|Q31AX4|SYL_PROM9 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9312) GN=leuS PE=3 SV=1 36 132 2.0E-07
sp|B8CXR8|SYL_HALOH Leucine--tRNA ligase OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=leuS PE=3 SV=1 749 933 3.0E-07
sp|Q3M3A3|SYL_ANAVT Leucine--tRNA ligase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=leuS PE=3 SV=1 36 132 3.0E-07
sp|A4XHE2|SYC_CALS8 Cysteine--tRNA ligase OS=Caldicellulosiruptor saccharolyticus (strain ATCC 43494 / DSM 8903 / Tp8T 6331) GN=cysS PE=3 SV=1 713 887 3.0E-07
sp|Q7VBZ5|SYL_PROMA Leucine--tRNA ligase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=leuS PE=3 SV=1 34 132 3.0E-07
sp|Q2JV13|SYL_SYNJA Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-3-3Ab) GN=leuS PE=3 SV=1 35 151 4.0E-07
sp|Q2YXH4|SYI_STAAB Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=ileS PE=3 SV=1 338 973 4.0E-07
sp|B9MMM6|SYC_CALBD Cysteine--tRNA ligase OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=cysS PE=3 SV=1 713 887 4.0E-07
sp|Q58413|SYV_METJA Valine--tRNA ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=valS PE=3 SV=1 30 135 4.0E-07
sp|A3PCW8|SYL_PROM0 Leucine--tRNA ligase OS=Prochlorococcus marinus (strain MIT 9301) GN=leuS PE=3 SV=1 36 132 5.0E-07
sp|A5GT82|SYL_SYNR3 Leucine--tRNA ligase OS=Synechococcus sp. (strain RCC307) GN=leuS PE=3 SV=1 24 132 6.0E-07
sp|B7JYA9|SYL_CYAP8 Leucine--tRNA ligase OS=Cyanothece sp. (strain PCC 8801) GN=leuS PE=3 SV=1 35 132 7.0E-07
sp|A8GTB4|SYV_RICRS Valine--tRNA ligase OS=Rickettsia rickettsii (strain Sheila Smith) GN=valS PE=3 SV=1 37 149 8.0E-07
sp|B0BUV1|SYV_RICRO Valine--tRNA ligase OS=Rickettsia rickettsii (strain Iowa) GN=valS PE=3 SV=1 37 149 8.0E-07
sp|Q8NX29|SYI_STAAW Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=ileS PE=3 SV=1 338 973 9.0E-07
sp|Q6GA19|SYI_STAAS Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=ileS PE=3 SV=1 338 973 9.0E-07
sp|Q67SB4|SYL_SYMTH Leucine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=leuS PE=3 SV=1 28 132 9.0E-07
sp|B1XP90|SYL_SYNP2 Leucine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=leuS PE=3 SV=1 28 151 1.0E-06
sp|Q7P0R1|SYL_CHRVO Leucine--tRNA ligase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=leuS PE=3 SV=1 748 935 2.0E-06
sp|Q2JHX0|SYL_SYNJB Leucine--tRNA ligase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=leuS PE=3 SV=1 35 151 2.0E-06
sp|A9AZ11|SYL_HERA2 Leucine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=leuS PE=3 SV=1 37 134 2.0E-06
sp|Q8DH61|SYL_THEEB Leucine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=leuS PE=3 SV=1 36 132 2.0E-06
sp|Q6GHP2|SYI_STAAR Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|P41972|SYI1_STAAU Isoleucine--tRNA ligase OS=Staphylococcus aureus GN=ileS PE=1 SV=1 517 973 2.0E-06
sp|A1VEL2|SYL_DESVV Leucine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=leuS PE=3 SV=1 35 134 2.0E-06
sp|A8Z3N1|SYI_STAAT Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|P67509|SYI_STAAN Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=ileS PE=1 SV=1 517 973 2.0E-06
sp|P67508|SYI_STAAM Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|A6QG93|SYI_STAAE Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|Q5HGN8|SYI_STAAC Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|A5IS79|SYI_STAA9 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|Q2FZ82|SYI_STAA8 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|Q2FHP4|SYI_STAA3 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|A6U113|SYI_STAA2 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|A7X1D8|SYI_STAA1 Isoleucine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=ileS PE=3 SV=1 517 973 2.0E-06
sp|Q72CT7|SYL_DESVH Leucine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=leuS PE=3 SV=1 35 134 2.0E-06
sp|A6LJM9|SYL_THEM4 Leucine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=leuS PE=3 SV=1 36 134 2.0E-06
sp|B3QM08|SYL_CHLP8 Leucine--tRNA ligase OS=Chlorobaculum parvum (strain NCIB 8327) GN=leuS PE=3 SV=1 35 134 3.0E-06
sp|Q182K8|SYL_PEPD6 Leucine--tRNA ligase OS=Peptoclostridium difficile (strain 630) GN=leuS PE=3 SV=1 745 934 3.0E-06
sp|Q0IAE0|SYL_SYNS3 Leucine--tRNA ligase OS=Synechococcus sp. (strain CC9311) GN=leuS PE=3 SV=1 34 132 3.0E-06
sp|Q3AF30|SYL_CARHZ Leucine--tRNA ligase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=leuS PE=3 SV=1 749 934 3.0E-06
sp|Q8KBY2|SYL_CHLTE Leucine--tRNA ligase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=leuS PE=3 SV=1 35 134 4.0E-06
sp|Q0SV78|SYL_CLOPS Leucine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=leuS PE=3 SV=1 35 134 4.0E-06
sp|Q89ZM4|SYV_BACTN Valine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=valS PE=3 SV=1 706 972 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0000166 nucleotide binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0006520 cellular amino acid metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0034660 ncRNA metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0006399 tRNA metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:1901265 nucleoside phosphate binding No
GO:0032553 ribonucleotide binding No
GO:0140098 catalytic activity, acting on RNA No
GO:0044281 small molecule metabolic process No
GO:0044238 primary metabolic process No
GO:1901363 heterocyclic compound binding No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0043436 oxoacid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0043168 anion binding No
GO:0019752 carboxylic acid metabolic process No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0097159 organic cyclic compound binding No
GO:1901360 organic cyclic compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0097367 carbohydrate derivative binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0016874 ligase activity No
GO:0043038 amino acid activation No
GO:0003674 molecular_function No
GO:0090304 nucleic acid metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0036094 small molecule binding No
GO:0071704 organic substance metabolic process No
GO:0005488 binding No
GO:0006807 nitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0043170 macromolecule metabolic process No
GO:0009987 cellular process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4724
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|107 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|1148
Ophiocordyceps camponoti-floridani Ophcf2|05728
Ophiocordyceps camponoti-rufipedis Ophun1|1625
Ophiocordyceps kimflemingae Ophio5|8428
Ophiocordyceps subramaniannii Hirsu2|9956

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|107
MTSTNTVPQAMEALKISPPKTKELKGTEKRDALIAIEKKYQAKWAEDGIFEQNAPTTHEVPLHSISAAELRQQVP
KFFGCIPYPYMNGVLHAGHTFSASKVDFAAAVARMQGKRALFPMGFHCTGMPIKACADKLVNEIKMFGQDFSGYR
DGGQGAKEDESARDSTAKKEDVTKFTTNKSKANAKTVKMKYQFQIMKSIGIPQQDIHQFADPQHWLKFFPPLAIR
DLKSMGCGIDWRRSFVTTDANPYYDAFVRWQMNRLRELDKIKFGKRYTIYSIKDGQPCMDHDRAEGEAVNPQEYT
AMKLRVLEWAPKAAEAIKGKLPEGSDVFLVPATLRSETMYGQTCCFVGPKITYGLYKADEKTYYVITERAARNMA
YQGILAKEGVIEKAVEIQGSDMIGTLVNAPLSCHTSGVRVLPMENVLPTKGTGVVTSVPSDSPDDCATLAELAKK
ADYYGIKKEWAELEPIAVISTPAYGDMCAPFLVKKLKIASPKDVKQLEEAKELAYKEGFYQGIMKIGEFKGEKVE
TAKPKVRAKLIAAGDAFSYSEPERKVVSRSGDDCIVALMDQWYLDYGEESWKREVLDWVENADGKKLATWGNETK
NSFEGVLNWLNQWACARSYGLGSKLPWDRQFLVESLSDSTIYMAYYTISHYLHKDLFGREKGIGNVGAEQMIDEV
WDYVFCRRELSDELVKLSSIPRETLESMRREFEYFYPLDMRSSGKDLIPNHLTFFLYVHLAIFPPEYWPRGVRAN
GHLMLNGEKMSKSTGNFMTLQELVAKYGADASRIAMADAGDAVTDANFEEDVADTSILRLYTLREWCEEMVREQK
ELRVGETNNFQDALFNNEMNSVAQEAMNQYSQTNYKLALKAALYELTSARDFYREACAAGGIKMHRELVMRYIEL
QCVLLAVVTPHWSEYIWVEVLKKGSSIHKAQFPKVPAVDAALSAKRDYVRNTSSNINSAEAAQLKKKAKGKEVSF
DPKKPKRASIFIKDKWPSWHAKYIELLREAFDASTKRVNDKELNGKIGQMGEMQKAMPFVQALKRRLLAGEPAEV
VLQQKLVFEEKETLEQMLPGLKRTTGLESCDVFVVDEGGKKGVRVADGQQVDIAAPIAEKAVPGVPTFFFENV*
Coding >OphauG2|107
ATGACCTCAACAAATACTGTGCCCCAGGCCATGGAGGCCTTGAAGATATCACCGCCCAAGACCAAAGAGCTCAAG
GGGACAGAGAAAAGAGATGCGCTTATTGCCATTGAGAAGAAATACCAGGCAAAATGGGCCGAGGACGGCATCTTT
GAGCAGAATGCACCAACGACGCACGAGGTGCCGCTACACTCCATTTCCGCTGCTGAACTGCGACAACAAGTGCCC
AAGTTCTTTGGCTGCATACCCTATCCGTATATGAATGGTGTGTTGCACGCGGGACACACATTTTCAGCCAGCAAG
GTCGACTTTGCCGCCGCTGTGGCCAGGATGCAAGGCAAGCGTGCCCTGTTCCCCATGGGCTTCCACTGCACTGGC
ATGCCCATAAAGGCCTGTGCGGACAAGCTTGTCAATGAGATCAAGATGTTCGGCCAGGACTTTTCCGGCTACAGG
GATGGCGGCCAGGGTGCGAAGGAGGATGAGTCCGCCCGTGACTCGACGGCCAAAAAAGAAGATGTTACCAAGTTT
ACTACCAACAAGAGCAAAGCCAACGCCAAGACTGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCAATTGGA
ATCCCTCAGCAAGATATTCACCAATTTGCCGATCCGCAGCACTGGCTCAAGTTCTTTCCTCCTCTAGCCATTCGC
GATCTGAAGAGCATGGGGTGCGGTATTGACTGGCGGCGTTCATTTGTCACTACAGATGCCAATCCTTACTACGAT
GCCTTTGTTCGCTGGCAAATGAACCGGCTCCGGGAACTCGACAAGATCAAATTTGGAAAGAGATACACCATATAT
TCCATCAAGGACGGCCAGCCCTGCATGGATCACGATCGCGCGGAAGGAGAAGCTGTGAATCCTCAAGAGTATACG
GCTATGAAGCTACGAGTCTTGGAATGGGCACCGAAAGCCGCTGAAGCCATCAAGGGAAAGCTTCCAGAGGGCTCT
GACGTCTTCCTGGTGCCTGCAACTCTCAGATCGGAGACCATGTATGGACAGACGTGCTGCTTTGTTGGACCCAAG
ATTACCTATGGTCTGTACAAAGCGGACGAAAAAACTTACTATGTGATTACGGAGAGAGCGGCCCGCAACATGGCC
TACCAGGGTATTTTGGCCAAGGAGGGCGTGATTGAAAAAGCTGTTGAGATACAGGGTTCTGACATGATTGGAACT
CTGGTCAATGCTCCGCTGTCTTGCCATACCTCGGGTGTTCGCGTCCTACCCATGGAGAATGTTTTGCCGACCAAG
GGTACCGGAGTCGTCACATCTGTGCCTTCAGACAGCCCAGATGACTGTGCTACTCTTGCTGAGCTGGCCAAAAAG
GCTGACTACTACGGCATCAAGAAGGAATGGGCTGAACTGGAACCCATTGCCGTCATTTCCACGCCAGCATATGGT
GACATGTGTGCACCTTTTCTTGTCAAGAAGCTTAAAATTGCGTCGCCCAAGGATGTGAAGCAGCTGGAAGAGGCC
AAGGAGCTCGCATACAAGGAAGGCTTCTACCAAGGCATCATGAAGATTGGCGAGTTCAAGGGTGAAAAGGTGGAG
ACGGCCAAACCCAAGGTCAGGGCAAAGCTGATTGCAGCTGGTGATGCCTTTTCCTACTCAGAACCCGAACGCAAG
GTGGTGAGCAGATCGGGCGACGACTGTATCGTGGCTCTGATGGACCAGTGGTACCTCGACTATGGCGAGGAATCT
TGGAAACGCGAGGTGCTCGACTGGGTGGAAAATGCAGACGGCAAGAAGCTCGCCACATGGGGAAATGAAACCAAG
AATAGCTTCGAAGGTGTTTTGAATTGGCTCAACCAGTGGGCATGTGCGAGAAGTTATGGGCTGGGATCAAAGTTG
CCGTGGGATCGTCAGTTCCTGGTGGAAAGCCTTAGCGACTCGACCATTTACATGGCCTACTACACCATCTCGCAC
TATCTGCATAAGGACCTGTTTGGGCGCGAAAAGGGCATTGGAAATGTGGGGGCTGAGCAGATGATTGATGAGGTG
TGGGATTACGTTTTTTGCCGCCGCGAGCTGAGCGACGAGTTGGTCAAGTTGTCGAGCATTCCCCGCGAGACGCTG
GAAAGCATGCGGCGCGAATTTGAGTATTTTTACCCGCTGGACATGCGAAGCTCGGGCAAAGATCTGATTCCTAAC
CATTTGACCTTTTTCCTCTATGTACACCTGGCAATCTTTCCACCAGAGTACTGGCCGCGGGGCGTGCGAGCCAAT
GGGCATTTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGAAACTTTATGACGCTTCAAGAATTGGTGGCC
AAGTACGGGGCTGACGCTTCCCGCATTGCTATGGCAGATGCTGGAGACGCTGTCACAGACGCAAACTTTGAGGAG
GACGTGGCAGACACTAGCATTTTGCGGCTGTACACGCTGCGCGAGTGGTGCGAGGAAATGGTGCGGGAACAAAAG
GAGCTACGAGTGGGAGAGACGAATAACTTCCAGGATGCCTTGTTCAACAACGAGATGAACAGCGTAGCGCAAGAG
GCGATGAACCAATATTCGCAGACAAACTACAAGCTAGCGCTCAAGGCGGCCCTGTACGAGCTGACGAGCGCACGA
GACTTTTACCGCGAGGCATGCGCTGCGGGCGGCATCAAGATGCATCGGGAGCTGGTTATGAGGTATATCGAGCTG
CAATGTGTGCTCTTGGCTGTTGTTACGCCACACTGGTCCGAGTACATCTGGGTCGAGGTGCTCAAGAAGGGGTCG
AGCATTCACAAGGCACAATTCCCCAAGGTGCCAGCCGTGGACGCGGCGCTCTCTGCCAAGCGAGACTATGTGCGC
AACACATCGTCGAATATCAACTCGGCAGAGGCAGCACAGCTCAAGAAGAAAGCCAAGGGCAAGGAGGTTTCGTTT
GACCCCAAGAAGCCCAAGAGGGCATCTATTTTCATCAAGGACAAGTGGCCGAGTTGGCATGCCAAGTACATTGAG
CTGCTCCGAGAGGCATTTGATGCAAGTACGAAGCGGGTAAACGACAAGGAGCTCAATGGCAAGATTGGGCAGATG
GGGGAAATGCAGAAGGCGATGCCGTTTGTGCAGGCACTCAAGAGACGTCTGCTGGCGGGAGAGCCGGCAGAGGTG
GTGCTGCAGCAGAAACTGGTGTTTGAGGAGAAGGAGACGCTTGAGCAGATGCTGCCGGGACTGAAGCGGACCACT
GGGCTCGAGTCTTGTGACGTGTTTGTGGTGGATGAGGGGGGCAAGAAGGGTGTGAGGGTGGCGGATGGGCAGCAA
GTTGATATTGCGGCGCCTATTGCGGAAAAGGCAGTTCCTGGAGTGCCGACGTTTTTCTTTGAAAATGTGTAG
Transcript >OphauG2|107
ATGACCTCAACAAATACTGTGCCCCAGGCCATGGAGGCCTTGAAGATATCACCGCCCAAGACCAAAGAGCTCAAG
GGGACAGAGAAAAGAGATGCGCTTATTGCCATTGAGAAGAAATACCAGGCAAAATGGGCCGAGGACGGCATCTTT
GAGCAGAATGCACCAACGACGCACGAGGTGCCGCTACACTCCATTTCCGCTGCTGAACTGCGACAACAAGTGCCC
AAGTTCTTTGGCTGCATACCCTATCCGTATATGAATGGTGTGTTGCACGCGGGACACACATTTTCAGCCAGCAAG
GTCGACTTTGCCGCCGCTGTGGCCAGGATGCAAGGCAAGCGTGCCCTGTTCCCCATGGGCTTCCACTGCACTGGC
ATGCCCATAAAGGCCTGTGCGGACAAGCTTGTCAATGAGATCAAGATGTTCGGCCAGGACTTTTCCGGCTACAGG
GATGGCGGCCAGGGTGCGAAGGAGGATGAGTCCGCCCGTGACTCGACGGCCAAAAAAGAAGATGTTACCAAGTTT
ACTACCAACAAGAGCAAAGCCAACGCCAAGACTGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCAATTGGA
ATCCCTCAGCAAGATATTCACCAATTTGCCGATCCGCAGCACTGGCTCAAGTTCTTTCCTCCTCTAGCCATTCGC
GATCTGAAGAGCATGGGGTGCGGTATTGACTGGCGGCGTTCATTTGTCACTACAGATGCCAATCCTTACTACGAT
GCCTTTGTTCGCTGGCAAATGAACCGGCTCCGGGAACTCGACAAGATCAAATTTGGAAAGAGATACACCATATAT
TCCATCAAGGACGGCCAGCCCTGCATGGATCACGATCGCGCGGAAGGAGAAGCTGTGAATCCTCAAGAGTATACG
GCTATGAAGCTACGAGTCTTGGAATGGGCACCGAAAGCCGCTGAAGCCATCAAGGGAAAGCTTCCAGAGGGCTCT
GACGTCTTCCTGGTGCCTGCAACTCTCAGATCGGAGACCATGTATGGACAGACGTGCTGCTTTGTTGGACCCAAG
ATTACCTATGGTCTGTACAAAGCGGACGAAAAAACTTACTATGTGATTACGGAGAGAGCGGCCCGCAACATGGCC
TACCAGGGTATTTTGGCCAAGGAGGGCGTGATTGAAAAAGCTGTTGAGATACAGGGTTCTGACATGATTGGAACT
CTGGTCAATGCTCCGCTGTCTTGCCATACCTCGGGTGTTCGCGTCCTACCCATGGAGAATGTTTTGCCGACCAAG
GGTACCGGAGTCGTCACATCTGTGCCTTCAGACAGCCCAGATGACTGTGCTACTCTTGCTGAGCTGGCCAAAAAG
GCTGACTACTACGGCATCAAGAAGGAATGGGCTGAACTGGAACCCATTGCCGTCATTTCCACGCCAGCATATGGT
GACATGTGTGCACCTTTTCTTGTCAAGAAGCTTAAAATTGCGTCGCCCAAGGATGTGAAGCAGCTGGAAGAGGCC
AAGGAGCTCGCATACAAGGAAGGCTTCTACCAAGGCATCATGAAGATTGGCGAGTTCAAGGGTGAAAAGGTGGAG
ACGGCCAAACCCAAGGTCAGGGCAAAGCTGATTGCAGCTGGTGATGCCTTTTCCTACTCAGAACCCGAACGCAAG
GTGGTGAGCAGATCGGGCGACGACTGTATCGTGGCTCTGATGGACCAGTGGTACCTCGACTATGGCGAGGAATCT
TGGAAACGCGAGGTGCTCGACTGGGTGGAAAATGCAGACGGCAAGAAGCTCGCCACATGGGGAAATGAAACCAAG
AATAGCTTCGAAGGTGTTTTGAATTGGCTCAACCAGTGGGCATGTGCGAGAAGTTATGGGCTGGGATCAAAGTTG
CCGTGGGATCGTCAGTTCCTGGTGGAAAGCCTTAGCGACTCGACCATTTACATGGCCTACTACACCATCTCGCAC
TATCTGCATAAGGACCTGTTTGGGCGCGAAAAGGGCATTGGAAATGTGGGGGCTGAGCAGATGATTGATGAGGTG
TGGGATTACGTTTTTTGCCGCCGCGAGCTGAGCGACGAGTTGGTCAAGTTGTCGAGCATTCCCCGCGAGACGCTG
GAAAGCATGCGGCGCGAATTTGAGTATTTTTACCCGCTGGACATGCGAAGCTCGGGCAAAGATCTGATTCCTAAC
CATTTGACCTTTTTCCTCTATGTACACCTGGCAATCTTTCCACCAGAGTACTGGCCGCGGGGCGTGCGAGCCAAT
GGGCATTTGATGCTCAACGGCGAGAAGATGAGCAAGAGCACGGGAAACTTTATGACGCTTCAAGAATTGGTGGCC
AAGTACGGGGCTGACGCTTCCCGCATTGCTATGGCAGATGCTGGAGACGCTGTCACAGACGCAAACTTTGAGGAG
GACGTGGCAGACACTAGCATTTTGCGGCTGTACACGCTGCGCGAGTGGTGCGAGGAAATGGTGCGGGAACAAAAG
GAGCTACGAGTGGGAGAGACGAATAACTTCCAGGATGCCTTGTTCAACAACGAGATGAACAGCGTAGCGCAAGAG
GCGATGAACCAATATTCGCAGACAAACTACAAGCTAGCGCTCAAGGCGGCCCTGTACGAGCTGACGAGCGCACGA
GACTTTTACCGCGAGGCATGCGCTGCGGGCGGCATCAAGATGCATCGGGAGCTGGTTATGAGGTATATCGAGCTG
CAATGTGTGCTCTTGGCTGTTGTTACGCCACACTGGTCCGAGTACATCTGGGTCGAGGTGCTCAAGAAGGGGTCG
AGCATTCACAAGGCACAATTCCCCAAGGTGCCAGCCGTGGACGCGGCGCTCTCTGCCAAGCGAGACTATGTGCGC
AACACATCGTCGAATATCAACTCGGCAGAGGCAGCACAGCTCAAGAAGAAAGCCAAGGGCAAGGAGGTTTCGTTT
GACCCCAAGAAGCCCAAGAGGGCATCTATTTTCATCAAGGACAAGTGGCCGAGTTGGCATGCCAAGTACATTGAG
CTGCTCCGAGAGGCATTTGATGCAAGTACGAAGCGGGTAAACGACAAGGAGCTCAATGGCAAGATTGGGCAGATG
GGGGAAATGCAGAAGGCGATGCCGTTTGTGCAGGCACTCAAGAGACGTCTGCTGGCGGGAGAGCCGGCAGAGGTG
GTGCTGCAGCAGAAACTGGTGTTTGAGGAGAAGGAGACGCTTGAGCAGATGCTGCCGGGACTGAAGCGGACCACT
GGGCTCGAGTCTTGTGACGTGTTTGTGGTGGATGAGGGGGGCAAGAAGGGTGTGAGGGTGGCGGATGGGCAGCAA
GTTGATATTGCGGCGCCTATTGCGGAAAAGGCAGTTCCTGGAGTGCCGACGTTTTTCTTTGAAAATGTGTAG
Gene >OphauG2|107
ATGACCTCAACAAATACTGTGCCCCAGGCCATGGAGGCCTTGAAGATATCACCGCCCAAGACCAAAGAGCTCAAG
GGGGTCAGTCATTGCAGTAGTCGAGCTTGCTTCTCTTCAAAGCTGACCACATATAGACAGAGAAAAGAGATGCGC
TTATTGCCATTGAGAAGAAATACCAGGCAAAATGGGCCGAGGACGGCATCTTTGAGCAGAATGCACCAACGACGC
ACGAGGTGCCGCTACACTCCATTTCCGCTGCTGAACTGCGACAACAAGTGCCCAAGTTCTTTGGCTGCATACCCT
ATCCGTATATGAATGGTGTGTTGCACGCGGGACACACATTTTCAGCCAGCAAGGTCGACTTTGCCGCCGCTGTGG
CCAGGATGCAAGGCAAGCGTGCCCTGTTCCCCATGGGCTTCCACTGCACTGGCATGCCCATAAAGGCCTGTGCGG
ACAAGCTTGTCAATGAGATCAAGATGTTCGGCCAGGACTTTTCCGGCTACAGGGATGGCGGCCAGGGTGCGAAGG
AGGATGAGTCCGCCCGTGACTCGACGGCCAAAAAAGAAGATGTTACCAAGTTTACTACCAACAAGAGCAAAGCCA
ACGCCAAGACTGTCAAGATGAAGTATCAGTTCCAGATCATGAAGTCAATTGGAATCCCTCAGCAAGATATTCACC
AATTTGCCGATCCGCAGCACTGGCTCAAGTTCTTTCCTCCTCTAGCCATTCGCGATCTGAAGAGCATGGGGTGCG
GTATTGACTGGCGGCGTTCATTTGTCACTACAGATGCCAATCCTTACTACGATGCCTTTGTTCGCTGGCAAATGA
ACCGGCTCCGGGAACTCGACAAGATCAAATTTGGAAAGAGATACACCATATATTCCATCAAGGACGGCCAGCCCT
GCATGGATCACGATCGCGCGGAAGGAGAAGCTGTGAATCCTCAAGAGTATACGGCTATGAAGCTACGAGTCTTGG
AATGGGCACCGAAAGCCGCTGAAGCCATCAAGGGAAAGCTTCCAGAGGGCTCTGACGTCTTCCTGGTGCCTGCAA
CTCTCAGATCGGAGACCATGTATGGACAGACGTGCTGCTTTGTTGGACCCAAGATTACCTATGGTCTGTACAAAG
CGGACGAAAAAACTTACTATGTGATTACGGAGAGAGCGGCCCGCAACATGGCCTACCAGGGTATTTTGGCCAAGG
AGGGCGTGATTGAAAAAGCTGTTGAGATACAGGGTTCTGACATGATTGGAACTCTGGTCAATGCTCCGCTGTCTT
GCCATACCTCGGGTGTTCGCGTCCTACCCATGGAGAATGTTTTGCCGACCAAGGGTACCGGAGTCGTCACATCTG
TGCCTTCAGACAGCCCAGATGACTGTGCTACTCTTGCTGAGCTGGCCAAAAAGGCTGACTACTACGGCATCAAGA
AGGAATGGGCTGAACTGGAACCCATTGCCGTCATTTCCACGCCAGCATATGGTGACATGTGTGCACCTTTTCTTG
TCAAGAAGCTTAAAATTGCGTCGCCCAAGGATGTGAAGCAGCTGGAAGAGGCCAAGGAGCTCGCATACAAGGAAG
GCTTCTACCAAGGCATCATGAAGATTGGCGAGTTCAAGGGTGAAAAGGTGGAGACGGCCAAACCCAAGGTCAGGG
CAAAGCTGATTGCAGCTGGTGATGCCTTTTCCTACTCAGAACCCGAACGCAAGGTGGTGAGCAGATCGGGCGACG
ACTGTATCGTGGCTCTGATGGACCAGTGGTACCTCGACTATGGCGAGGAATCTTGGAAACGCGAGGTGCTCGACT
GGGTGGAAAATGCAGACGGCAAGAAGCTCGCCACATGGGGAAATGAAACCAAGAATAGCTTCGAAGGTGTTTTGA
ATTGGCTCAACCAGTGGGCATGTGCGAGAAGTTATGGGCTGGGATCAAAGTTGCCGTGGGATCGTCAGTTCCTGG
TGGAAAGCCTTAGCGACTCGACCATTTACATGGCCTACTACACCATCTCGCACTATCTGCATAAGGACCTGTTTG
GGCGCGAAAAGGGCATTGGAAATGTGGGGGCTGAGCAGATGATTGATGAGGTGTGGGATTACGTTTTTTGCCGCC
GCGAGCTGAGCGACGAGTTGGTCAAGTTGTCGAGCATTCCCCGCGAGACGCTGGAAAGCATGCGGCGCGAATTTG
AGTATTTTTACCCGCTGGACATGCGAAGCTCGGGCAAAGATCTGATTCCTAACCATTTGACCTTTTTCCTCTATG
TACACCTGGCAATCTTTCCACCAGAGTACTGGCCGCGGGGCGTGCGAGCCAATGGGCATTTGATGCTCAACGGCG
AGAAGATGAGCAAGAGCACGGGAAACTTTATGACGCTTCAAGAATTGGTGGCCAAGTACGGGGCTGACGCTTCCC
GCATTGCTATGGCAGATGCTGGAGACGCTGTCACAGACGCAAACTTTGAGGAGGACGTGGCAGACACTAGCATTT
TGCGGCTGTACACGCTGCGCGAGTGGTGCGAGGAAATGGTGCGGGAACAAAAGGAGCTACGAGTGGGAGAGACGA
ATAACTTCCAGGATGCCTTGTTCAACAACGAGATGAACAGCGTAGCGCAAGAGGCGATGAACCAATATTCGCAGA
CAAACTACAAGCTAGCGCTCAAGGCGGCCCTGTACGAGCTGACGAGCGCACGAGACTTTTACCGCGAGGCATGCG
CTGCGGGCGGCATCAAGATGCATCGGGAGCTGGTTATGAGGTATATCGAGCTGCAATGTGTGCTCTTGGCTGTTG
TTACGCCACACTGGTCCGAGTACATCTGGGTCGAGGTGCTCAAGAAGGGGTCGAGCATTCACAAGGCACAATTCC
CCAAGGTGCCAGCCGTGGACGCGGCGCTCTCTGCCAAGCGAGACTATGTGCGCAACACATCGTCGAATATCAACT
CGGCAGAGGCAGCACAGCTCAAGAAGAAAGCCAAGGGCAAGGAGGTTTCGTTTGACCCCAAGAAGCCCAAGAGGG
CATCTATTTTCATCAAGGACAAGTGGCCGAGTTGGCATGCCAAGTACATTGAGCTGCTCCGAGAGGCATTTGATG
CAAGTACGAAGCGGGTAAACGACAAGGAGCTCAATGGCAAGATTGGGCAGATGGGGGAAATGCAGAAGGCGATGC
CGTTTGTGCAGGCACTCAAGAGACGTCTGCTGGCGGGAGAGCCGGCAGAGGTGGTGCTGCAGCAGAAACTGGTGT
TTGAGGAGAAGGAGACGCTTGAGCAGATGCTGCCGGGACTGAAGCGGACCACTGGGCTCGAGTCTTGTGACGTGT
TTGTGGTGGATGAGGGGGGCAAGAAGGGTGTGAGGGTGGCGGATGGGCAGCAAGTTGATATTGCGGCGCCTATTG
CGGAAAAGGCAGTTCCTGGAGTGCCGACGTTTTTCTTTGAAAATGTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail