Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1065
Gene name
LocationContig_1292:78..3260
Strand+
Gene length (bp)3182
Transcript length (bp)2865
Coding sequence length (bp)2865
Protein length (aa) 955

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13432 TPR_16 Tetratricopeptide repeat 1.8E-06 169 220
PF13176 TPR_7 Tetratricopeptide repeat 3.3E-02 423 454

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74458|SFC4_SCHPO Transcription factor tau subunit sfc4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sfc4 PE=1 SV=1 12 921 1.0E-59
sp|P33339|TFC4_YEAST Transcription factor tau 131 kDa subunit OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TFC4 PE=1 SV=1 80 954 4.0E-59
sp|Q9Y5Q9|TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens GN=GTF3C3 PE=1 SV=1 56 475 9.0E-14
sp|Q9Y5Q9|TF3C3_HUMAN General transcription factor 3C polypeptide 3 OS=Homo sapiens GN=GTF3C3 PE=1 SV=1 803 913 3.0E-09

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 64 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1065
MMASTNLGGDAGSDADSDLDKLQNDMVKLDESVRSFLASHGGLHQEMHAMRGGPRGRGARGPRKAAKPRGDITTR
LFNINRAFVSGDYEQALDLALEVIRINAETYQAWTTFSSILRARGEADHALLTMVYAAHLRPKDVTAWLKSATLA
LDAVEQVDQNRADVDKMLQVARTCFSAALRADPTHVEARLGKAAVCHRQGHLAAAISEYKLVLKHRPQDAEVVRK
LAAACLGSRNAEANIGIAIEAYRRLFRVEEQAQTRDYPRDLWPHVGIYAGLFAASGRPREAIGELKSLSRWLVGR
GSEDYWKTWQQDDREWDADDQRRISVPEYDSSKADPSLHGNSLPMDLRIRLSTYRLRLGDECEALRHLSWLNTAE
TKTKEIVSDCSLVVYELATELATCGQTARAVELFQLLLSTPGEADAATLLQLGRCHQTLGQQPMAEEYFLAAIDV
DQDNIDARVALANMYEKAREDEEALILAAEALALQEARGQTHAMDSDGSNISVGLGEQRYGDRRRALAPSLTKSK
PPRPSQASVVPRRYRPKRLAGPDMRLRDEQARALKLLNQFKHVRDLKHKIVAGHGHLVPLWMAMSKELVDDFRYL
KRFYTWDKYLRCIGPSQSNGIGQRDCDSELSQMYERLSRSVAPQADHSVSTCSSSDLHAHRGIAFEDWLDLFLDY
AIGLALAHRREEAYSICQAAKDSTVFQEPQHNFFIYLAWSVCAIYTNDEERCVATARHLMSDGALSDSCRMFALL
SRLCQSPVSWYTSGPAQKFIMRQIKAIDARHRLSVSQHGQGSSPSDGGVDVCLLMLYGHILFTSTSYTYSLGYFL
RARALDPTNSMINLSLGLAYVHSGLKRQSTNRQYLLLQGQAFLTLYLDGCEEEHGGEVAERFYNVGRLFQLLGIN
YLSSRYYVQALDVYNQGGGTKDLSTCILINTILSHMSVRNNAIALALIKNQLHI*
Coding >OphauG2|1065
ATGATGGCGTCGACGAATCTAGGTGGCGACGCAGGATCCGATGCAGATTCGGATCTAGACAAGCTCCAGAATGAC
ATGGTCAAGCTGGACGAGTCGGTACGCTCCTTTCTTGCATCACATGGCGGACTTCATCAAGAAATGCATGCTATG
CGCGGAGGCCCTCGAGGTCGAGGTGCGCGTGGTCCCCGAAAAGCAGCTAAGCCAAGAGGGGACATCACGACTCGC
CTATTCAATATCAACCGGGCCTTCGTCAGTGGCGACTATGAGCAAGCGCTTGACTTGGCATTGGAGGTGATTCGC
ATTAATGCGGAGACGTACCAGGCATGGACTACGTTCTCGTCGATATTAAGGGCGAGGGGGGAAGCGGATCATGCC
CTTTTGACAATGGTCTACGCCGCTCATCTTCGACCCAAGGACGTGACGGCATGGCTCAAAAGTGCCACGCTTGCA
CTAGACGCAGTGGAGCAAGTCGACCAAAATAGGGCCGACGTGGATAAAATGCTACAGGTGGCTCGCACGTGCTTC
TCAGCTGCTCTGAGAGCTGACCCGACGCATGTGGAAGCCAGACTGGGCAAGGCTGCCGTATGTCATCGGCAGGGC
CATCTCGCCGCTGCTATCTCCGAGTATAAACTGGTACTCAAGCATAGACCCCAGGATGCCGAGGTGGTGAGAAAG
CTTGCTGCGGCGTGCCTTGGCAGCAGGAATGCCGAAGCAAATATTGGCATTGCCATTGAGGCGTATCGACGCTTG
TTCCGTGTCGAGGAGCAAGCGCAGACACGCGACTACCCACGAGACTTGTGGCCTCATGTCGGCATTTATGCTGGG
CTCTTTGCTGCCTCTGGCCGCCCCAGAGAAGCCATTGGCGAGCTTAAGTCATTATCACGTTGGCTTGTTGGCCGA
GGATCAGAGGACTACTGGAAGACTTGGCAGCAAGACGACCGCGAGTGGGACGCCGATGACCAACGCCGCATCTCC
GTCCCCGAGTATGACAGCTCTAAGGCAGATCCGTCGCTGCACGGGAATTCCCTGCCGATGGATCTGCGCATCCGG
TTATCGACCTACCGCCTTAGGCTCGGTGACGAATGCGAGGCATTGAGACATTTGAGCTGGCTGAATACCGCGGAG
ACCAAGACCAAGGAGATTGTCAGCGACTGTTCATTGGTAGTCTACGAACTGGCAACGGAACTGGCTACATGTGGG
CAGACAGCAAGGGCTGTCGAGCTCTTTCAACTGTTACTCTCCACTCCGGGAGAAGCAGATGCTGCCACGCTTCTG
CAACTTGGACGGTGCCATCAAACGTTAGGACAGCAACCTATGGCTGAGGAGTACTTTCTAGCGGCTATTGATGTC
GACCAAGACAATATTGATGCCCGAGTTGCGCTTGCAAACATGTACGAGAAGGCAAGAGAGGATGAGGAGGCTCTG
ATACTGGCTGCCGAGGCTTTGGCACTACAGGAGGCCCGAGGCCAGACACATGCAATGGACTCTGATGGGTCTAAC
ATAAGTGTTGGTCTTGGCGAGCAACGATATGGCGATAGGAGGCGAGCATTGGCACCGTCATTAACCAAGTCCAAG
CCGCCACGGCCATCGCAGGCCTCGGTGGTACCGAGACGCTACCGTCCGAAGAGACTTGCTGGCCCCGACATGCGC
CTGCGAGACGAACAAGCCCGAGCGTTGAAGCTTTTGAATCAGTTTAAGCACGTCCGGGATTTGAAACACAAGATT
GTTGCCGGCCATGGCCATCTTGTGCCCCTGTGGATGGCCATGTCCAAGGAGCTGGTTGATGACTTCCGCTACCTT
AAACGCTTCTACACCTGGGATAAGTATCTGCGATGCATTGGTCCCTCACAGAGTAATGGCATTGGCCAACGTGAT
TGCGACTCAGAGCTCTCGCAGATGTATGAGCGTCTTTCTCGATCTGTTGCTCCACAGGCAGATCACTCAGTTAGC
ACATGTAGTTCGTCTGATTTGCATGCTCATCGCGGAATTGCCTTTGAAGACTGGCTAGATCTCTTTCTCGATTAC
GCCATCGGGCTCGCCCTAGCACATCGTAGAGAGGAAGCCTATAGCATATGTCAAGCAGCCAAAGACTCGACTGTT
TTTCAAGAGCCCCAGCACAACTTCTTTATATATCTTGCTTGGAGCGTATGTGCCATTTACACTAACGATGAGGAG
CGCTGTGTGGCAACAGCTCGCCATCTCATGTCTGATGGCGCCTTGTCCGACTCGTGTCGCATGTTTGCTCTCCTT
TCACGACTTTGCCAGTCTCCAGTGTCGTGGTACACGTCGGGGCCGGCGCAAAAGTTTATTATGCGCCAAATCAAA
GCCATTGACGCCAGACACCGCCTGTCTGTATCTCAGCATGGGCAAGGTAGCAGTCCATCAGATGGCGGTGTCGAT
GTTTGCCTCCTCATGCTCTATGGTCATATACTCTTTACATCAACTAGTTATACTTATTCACTTGGCTACTTTTTA
CGAGCTCGGGCTCTCGATCCAACCAACTCAATGATCAATCTTAGTCTAGGCCTAGCATATGTTCACTCAGGACTC
AAGCGGCAATCAACGAACCGACAATATCTTCTTCTGCAAGGCCAGGCATTTCTAACCCTGTACCTCGACGGCTGC
GAGGAAGAGCATGGTGGTGAAGTGGCCGAGAGATTCTATAATGTTGGACGACTCTTCCAGCTACTTGGCATCAAC
TATCTGAGCTCGAGATACTATGTACAGGCCTTGGATGTCTACAACCAGGGTGGTGGGACCAAGGACCTATCCACC
TGCATCTTGATAAACACCATTCTCTCTCACATGTCAGTGAGGAATAATGCCATTGCTCTCGCGCTTATCAAGAAC
CAGCTACACATTTAA
Transcript >OphauG2|1065
ATGATGGCGTCGACGAATCTAGGTGGCGACGCAGGATCCGATGCAGATTCGGATCTAGACAAGCTCCAGAATGAC
ATGGTCAAGCTGGACGAGTCGGTACGCTCCTTTCTTGCATCACATGGCGGACTTCATCAAGAAATGCATGCTATG
CGCGGAGGCCCTCGAGGTCGAGGTGCGCGTGGTCCCCGAAAAGCAGCTAAGCCAAGAGGGGACATCACGACTCGC
CTATTCAATATCAACCGGGCCTTCGTCAGTGGCGACTATGAGCAAGCGCTTGACTTGGCATTGGAGGTGATTCGC
ATTAATGCGGAGACGTACCAGGCATGGACTACGTTCTCGTCGATATTAAGGGCGAGGGGGGAAGCGGATCATGCC
CTTTTGACAATGGTCTACGCCGCTCATCTTCGACCCAAGGACGTGACGGCATGGCTCAAAAGTGCCACGCTTGCA
CTAGACGCAGTGGAGCAAGTCGACCAAAATAGGGCCGACGTGGATAAAATGCTACAGGTGGCTCGCACGTGCTTC
TCAGCTGCTCTGAGAGCTGACCCGACGCATGTGGAAGCCAGACTGGGCAAGGCTGCCGTATGTCATCGGCAGGGC
CATCTCGCCGCTGCTATCTCCGAGTATAAACTGGTACTCAAGCATAGACCCCAGGATGCCGAGGTGGTGAGAAAG
CTTGCTGCGGCGTGCCTTGGCAGCAGGAATGCCGAAGCAAATATTGGCATTGCCATTGAGGCGTATCGACGCTTG
TTCCGTGTCGAGGAGCAAGCGCAGACACGCGACTACCCACGAGACTTGTGGCCTCATGTCGGCATTTATGCTGGG
CTCTTTGCTGCCTCTGGCCGCCCCAGAGAAGCCATTGGCGAGCTTAAGTCATTATCACGTTGGCTTGTTGGCCGA
GGATCAGAGGACTACTGGAAGACTTGGCAGCAAGACGACCGCGAGTGGGACGCCGATGACCAACGCCGCATCTCC
GTCCCCGAGTATGACAGCTCTAAGGCAGATCCGTCGCTGCACGGGAATTCCCTGCCGATGGATCTGCGCATCCGG
TTATCGACCTACCGCCTTAGGCTCGGTGACGAATGCGAGGCATTGAGACATTTGAGCTGGCTGAATACCGCGGAG
ACCAAGACCAAGGAGATTGTCAGCGACTGTTCATTGGTAGTCTACGAACTGGCAACGGAACTGGCTACATGTGGG
CAGACAGCAAGGGCTGTCGAGCTCTTTCAACTGTTACTCTCCACTCCGGGAGAAGCAGATGCTGCCACGCTTCTG
CAACTTGGACGGTGCCATCAAACGTTAGGACAGCAACCTATGGCTGAGGAGTACTTTCTAGCGGCTATTGATGTC
GACCAAGACAATATTGATGCCCGAGTTGCGCTTGCAAACATGTACGAGAAGGCAAGAGAGGATGAGGAGGCTCTG
ATACTGGCTGCCGAGGCTTTGGCACTACAGGAGGCCCGAGGCCAGACACATGCAATGGACTCTGATGGGTCTAAC
ATAAGTGTTGGTCTTGGCGAGCAACGATATGGCGATAGGAGGCGAGCATTGGCACCGTCATTAACCAAGTCCAAG
CCGCCACGGCCATCGCAGGCCTCGGTGGTACCGAGACGCTACCGTCCGAAGAGACTTGCTGGCCCCGACATGCGC
CTGCGAGACGAACAAGCCCGAGCGTTGAAGCTTTTGAATCAGTTTAAGCACGTCCGGGATTTGAAACACAAGATT
GTTGCCGGCCATGGCCATCTTGTGCCCCTGTGGATGGCCATGTCCAAGGAGCTGGTTGATGACTTCCGCTACCTT
AAACGCTTCTACACCTGGGATAAGTATCTGCGATGCATTGGTCCCTCACAGAGTAATGGCATTGGCCAACGTGAT
TGCGACTCAGAGCTCTCGCAGATGTATGAGCGTCTTTCTCGATCTGTTGCTCCACAGGCAGATCACTCAGTTAGC
ACATGTAGTTCGTCTGATTTGCATGCTCATCGCGGAATTGCCTTTGAAGACTGGCTAGATCTCTTTCTCGATTAC
GCCATCGGGCTCGCCCTAGCACATCGTAGAGAGGAAGCCTATAGCATATGTCAAGCAGCCAAAGACTCGACTGTT
TTTCAAGAGCCCCAGCACAACTTCTTTATATATCTTGCTTGGAGCGTATGTGCCATTTACACTAACGATGAGGAG
CGCTGTGTGGCAACAGCTCGCCATCTCATGTCTGATGGCGCCTTGTCCGACTCGTGTCGCATGTTTGCTCTCCTT
TCACGACTTTGCCAGTCTCCAGTGTCGTGGTACACGTCGGGGCCGGCGCAAAAGTTTATTATGCGCCAAATCAAA
GCCATTGACGCCAGACACCGCCTGTCTGTATCTCAGCATGGGCAAGGTAGCAGTCCATCAGATGGCGGTGTCGAT
GTTTGCCTCCTCATGCTCTATGGTCATATACTCTTTACATCAACTAGTTATACTTATTCACTTGGCTACTTTTTA
CGAGCTCGGGCTCTCGATCCAACCAACTCAATGATCAATCTTAGTCTAGGCCTAGCATATGTTCACTCAGGACTC
AAGCGGCAATCAACGAACCGACAATATCTTCTTCTGCAAGGCCAGGCATTTCTAACCCTGTACCTCGACGGCTGC
GAGGAAGAGCATGGTGGTGAAGTGGCCGAGAGATTCTATAATGTTGGACGACTCTTCCAGCTACTTGGCATCAAC
TATCTGAGCTCGAGATACTATGTACAGGCCTTGGATGTCTACAACCAGGGTGGTGGGACCAAGGACCTATCCACC
TGCATCTTGATAAACACCATTCTCTCTCACATGTCAGTGAGGAATAATGCCATTGCTCTCGCGCTTATCAAGAAC
CAGCTACACATTTAA
Gene >OphauG2|1065
ATGATGGCGTCGACGAATCTGTGTGTCACGATTTGACCCAAGCTATATATTGGCTACAGCTAACATTGCTTAATA
AAGAGGTGGCGACGCAGGATCCGATGCAGATTCGGATCTAGACAAGCTCCAGAATGACATGGTCAAGCTGGACGA
GTCGGTACGCTCCTTTCTTGCATCACATGGCGGACTTCATCAAGAAATGCATGCTATGCGCGGAGGCCCTCGAGG
TCGAGGTGCGCGTGGTCCCCGAAAAGCAGCTAAGCCAAGAGGGGACATCACGACTCGCCTATTCAATATCAACCG
GGCCTTCGTCAGTGGCGACTATGAGCAAGCGCTTGACTTGGCATTGGAGGTGATTCGCATTAATGCGGAGACGTA
CCAGGCATGGACTACGTTCTCGTCGATATTAAGGGCGAGGGGGGAAGCGGATCATGCCCTTTTGACAATGGTCTA
CGCCGCTCATCTTCGACCCAAGGACGTGACGGCATGGCTCAAAAGTGCCACGCTTGCACTAGACGCAGTGGAGCA
AGTCGACCAAAATAGGGCCGACGTGGATAAAATGCTACAGGTGGCTCGCACGTGCTTCTCAGCTGCTCTGAGAGC
TGACCCGACGCATGTGGAAGCCAGACTGGGCAAGGCTGCCGTATGTCATCGGCAGGGCCATCTCGCCGCTGCTAT
CTCCGAGTATAAACTGGTACTCAAGCATAGACCCCAGGATGCCGAGGTGGTGAGAAAGCTTGCTGCGGCGTGCCT
TGGCAGCAGGAATGCCGAAGCAAATATTGGCATTGCCATTGAGGCGTATCGACGCTTGTTCCGTGTCGAGGAGCA
AGCGCAGACACGCGACTACCCACGAGACTTGTGGCCTCATGTCGGCATTTATGCTGGGCTCTTTGCTGCCTCTGG
CCGCCCCAGAGAAGCCATTGGCGAGCTTAAGTCATTATCACGTTGGCTTGTTGGCCGAGGATCAGAGGACTACTG
GAAGACTTGGCAGCAAGACGACCGCGAGTGGGACGCCGATGACCAACGCCGCATCTCCGTCCCCGAGTATGACAG
CTCTAAGGCAGATCCGTCGCTGCACGGGAATTCCCTGCCGATGGATCTGCGCATCCGGTTATCGACCTACCGCCT
TAGGCTCGGTGACGAATGCGAGGCATTGGTAAGAAGAGATAAGATTGGAAATGCATTCTCGTCATGACTGACTTG
TAGCTGTGCGACTGGTAGAGACATTTGAGCTGGCTGAATACCGCGGAGACCAAGACCAAGGAGATTGTCAGCGAC
TGTTCATTGGTAGTCTACGAACTGGCAACGGAACTGGCTACATGTGGGCAGACAGCAAGGGCTGTCGAGCTCTTT
CAACTGTTACTCTCCACTCCGGGAGAAGCAGATGCTGCCACGCTTCTGCAACTTGGACGGTGCCATCAAACGTTA
GGACAGCAACCTATGGCTGAGGAGTACTTTCTAGCGGCTATTGATGTCGACCAAGACAATATTGATGCCCGAGTT
GCGCTTGCAAACATGTACGAGAAGGCAAGAGAGGATGAGGAGGCTCTGATACTGGCTGCCGAGGCTTTGGCACTA
CAGGAGGCCCGAGGCCAGACACATGCAATGGACTCTGATGGGTCTAACATAAGTGTTGGTCTTGGCGAGCAACGA
TATGGCGATAGGAGGCGAGCATTGGCACCGTCATTAACCAAGTCCAAGCCGCCACGGCCATCGCAGGCCTCGGTG
GTACCGAGACGCTACCGTCCGAAGAGACTTGCTGGCCCCGACATGCGCCTGCGAGACGAACAAGCCCGAGCGTTG
AAGCTTTTGAATCAGTTTAAGCACGTCCGGGATTTGAAACACAAGATTGTTGCCGGCCATGGCCATCTTGTGCCC
CTGTGGATGGCCATGTCCAAGGAGCTGGTTGATGACTTCCGCTACCTTAAACGCTTCTACACCTGGGATAAGTAT
CTGCGATGCATTGGTCCCTCACAGAGTAATGGCATTGGCCAACGTGATTGCGACTCAGAGCTCTCGCAGATGTAT
GAGCGTCTTTCTCGATGTAAGCTATGACTGTTTTGTCGACCTGCCGCTCCATTACTATTACGTGCTGACAATACT
TCAACAGCTGTTGCTCCACAGGCAGATCACTCAGTTAGCACATGTAGTTCGTCTGATTTGCATGCTCATCGCGGA
ATTGCCTTTGAAGACTGGCTAGATCTCTTTCTCGATTACGCCATCGGGCTCGCCCTAGCACATCGTAGAGAGGAA
GCCTATAGCATATGTCAAGCAGCCAAAGACTCGACTGTTTTTCAAGAGCCCCAGCACAACTTCTTTATATATCTT
GCTTGGAGCGGTGAGCTGTTCTTTATATTGGCTCTGCAGTCAAAAAGACAATAGGCGTGACTGACGGCCGCTTGC
AGTATGTGCCATTTACACTAACGATGAGGAGCGCTGTGTGGCAACAGCTCGCCATCTCATGTCTGATGGCGCCTT
GTCCGACTCGTGTCGCATGTTTGCTCTCCTTTCACGACTTTGCCAGTCTCCAGTGTCGTGGTACACGTCGGGGCC
GGCGCAAAAGTTTATTATGCGCCAAATCAAAGCCATTGACGCCAGACACCGCCTGTCTGTATCTCAGCATGGGCA
AGGTAGCAGTCCATCAGATGGCGGTGTCGATGTTTGCCTCCTCATGCTCTATGGTCATATACTCTTTACATCAAC
TAGTTATACTTATTCACTTGGTATGCTGCGTCACTGTCCTCTTTCATGCTCAGGATATCACATTTTAACCAAGAC
GCAAAGGCTACTTTTTACGAGCTCGGGCTCTCGATCCAACCAACTCAATGATCAATCTTAGTCTAGGCCTAGCAT
ATGTTCACTCAGGACTCAAGCGGCAATCAACGAACCGACAATATCTTCTTCTGCAAGGCCAGGCATTTCTAACCC
TGTACCTCGACGGCTGCGAGGAAGAGCATGGTGGTGAAGTGGCCGAGAGATTCTATAATGTTGGACGACTCTTCC
AGCTACTTGGCATCAACTATCTGAGCTCGAGATACTATGTACAGGCCTTGGATGTCTACAACCAGGGTGGTGGGA
CCAAGGACCTATCCACCTGCATCTTGATAAACACCATTCTCTCTCACATGTCAGTGAGGAATAATGCCATTGCTC
TCGCGCTTATCAAGAACCAGCTACACATTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail