Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1057
Gene name
LocationContig_129:19925..21161
Strand+
Gene length (bp)1236
Transcript length (bp)1236
Coding sequence length (bp)1236
Protein length (aa) 412

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999657

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup203
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1057 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6505
Ophiocordyceps australis map64 (Brazil) OphauB2|7186
Ophiocordyceps camponoti-floridani Ophcf2|05196
Ophiocordyceps camponoti-floridani Ophcf2|05197
Ophiocordyceps camponoti-rufipedis Ophun1|5097
Ophiocordyceps kimflemingae Ophio5|8170
Ophiocordyceps subramaniannii Hirsu2|1068
Ophiocordyceps subramaniannii Hirsu2|2263
Ophiocordyceps subramaniannii Hirsu2|5885

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1057
MILCRAISFFLIATGVNASVFSGKQGHLDLEYMIKATHQARAIVLYLKSFVRDHMLPPPHINKKLPTQGPCFFQH
QPLVPASEAIDIRIVAHEDDEVITGSRPVTIEIRSSTARIDSSKLGWKMEDEELSSIELSAGASGAGVEVSTSVS
TGTRTNLEKSGENELQQEHQMEVSKSFECSSYTICTVQTWTYVAQIQGTCPRVPMIDAKCIKDEALKQLCAANMF
NPSCPPPPPIELDFWESMDYMIWTRTKRKRSMQTQGIDMIQFYQSPLYQTLERNLWHHRNISLPSINDQWPAFNK
IQQFYYNMTKMDGSQAGQVLPETLRNGIWRASEDKYNIVYNSIDRCNFSTPLYISKGKPKRTQVIIERPIDFSTG
RAARWAKSGRERWQQNLYAQRWKGGVKVTVLSNDIY*
Coding >OphauG2|1057
ATGATTCTTTGTAGAGCCATCAGCTTCTTTCTGATTGCCACTGGGGTGAATGCCTCCGTATTCTCTGGTAAACAA
GGTCATCTGGATCTGGAATACATGATTAAAGCAACACACCAAGCTCGAGCCATTGTCTTGTATCTCAAAAGCTTT
GTCCGCGACCACATGCTACCACCACCCCATATCAACAAGAAACTTCCGACTCAAGGCCCATGTTTTTTCCAACAC
CAACCACTAGTCCCGGCTTCCGAGGCCATCGATATCCGAATAGTTGCTCACGAAGATGACGAGGTAATCACGGGA
TCACGCCCTGTGACAATAGAAATTAGGTCGTCCACCGCCCGCATCGATTCTTCGAAACTAGGCTGGAAAATGGAA
GATGAAGAACTCTCTTCAATAGAGCTCAGCGCTGGCGCCAGCGGGGCGGGCGTTGAAGTGTCGACTTCGGTATCT
ACTGGGACTAGAACTAACCTGGAAAAATCTGGTGAAAACGAGCTTCAGCAAGAGCATCAGATGGAGGTCAGCAAG
TCTTTTGAATGTTCGTCATATACTATTTGCACTGTTCAGACATGGACCTATGTTGCACAAATCCAGGGCACGTGC
CCTCGTGTTCCTATGATCGATGCAAAGTGTATTAAAGACGAGGCTTTGAAACAACTTTGCGCTGCAAACATGTTT
AATCCATCTTGCCCGCCTCCTCCGCCCATCGAATTGGATTTTTGGGAATCGATGGACTACATGATCTGGACTCGA
ACCAAGAGAAAACGATCGATGCAAACTCAGGGTATAGACATGATCCAATTCTATCAATCGCCATTATACCAAACT
CTCGAACGAAATTTATGGCATCACCGGAATATATCCCTTCCTTCAATCAATGACCAGTGGCCAGCATTTAATAAG
ATACAACAATTCTACTATAACATGACCAAGATGGACGGCTCACAAGCAGGCCAAGTACTTCCGGAAACATTGCGC
AACGGTATTTGGCGAGCCTCTGAGGACAAGTACAACATTGTGTACAACTCGATCGACCGATGTAACTTTAGCACG
CCTTTATACATCAGTAAAGGGAAGCCGAAAAGGACCCAAGTTATTATCGAGCGACCTATAGACTTTTCGACTGGT
AGAGCTGCTAGGTGGGCGAAAAGTGGAAGAGAAAGATGGCAGCAAAATCTATATGCTCAGCGTTGGAAGGGAGGA
GTCAAGGTTACAGTTCTGAGCAATGATATATATTAG
Transcript >OphauG2|1057
ATGATTCTTTGTAGAGCCATCAGCTTCTTTCTGATTGCCACTGGGGTGAATGCCTCCGTATTCTCTGGTAAACAA
GGTCATCTGGATCTGGAATACATGATTAAAGCAACACACCAAGCTCGAGCCATTGTCTTGTATCTCAAAAGCTTT
GTCCGCGACCACATGCTACCACCACCCCATATCAACAAGAAACTTCCGACTCAAGGCCCATGTTTTTTCCAACAC
CAACCACTAGTCCCGGCTTCCGAGGCCATCGATATCCGAATAGTTGCTCACGAAGATGACGAGGTAATCACGGGA
TCACGCCCTGTGACAATAGAAATTAGGTCGTCCACCGCCCGCATCGATTCTTCGAAACTAGGCTGGAAAATGGAA
GATGAAGAACTCTCTTCAATAGAGCTCAGCGCTGGCGCCAGCGGGGCGGGCGTTGAAGTGTCGACTTCGGTATCT
ACTGGGACTAGAACTAACCTGGAAAAATCTGGTGAAAACGAGCTTCAGCAAGAGCATCAGATGGAGGTCAGCAAG
TCTTTTGAATGTTCGTCATATACTATTTGCACTGTTCAGACATGGACCTATGTTGCACAAATCCAGGGCACGTGC
CCTCGTGTTCCTATGATCGATGCAAAGTGTATTAAAGACGAGGCTTTGAAACAACTTTGCGCTGCAAACATGTTT
AATCCATCTTGCCCGCCTCCTCCGCCCATCGAATTGGATTTTTGGGAATCGATGGACTACATGATCTGGACTCGA
ACCAAGAGAAAACGATCGATGCAAACTCAGGGTATAGACATGATCCAATTCTATCAATCGCCATTATACCAAACT
CTCGAACGAAATTTATGGCATCACCGGAATATATCCCTTCCTTCAATCAATGACCAGTGGCCAGCATTTAATAAG
ATACAACAATTCTACTATAACATGACCAAGATGGACGGCTCACAAGCAGGCCAAGTACTTCCGGAAACATTGCGC
AACGGTATTTGGCGAGCCTCTGAGGACAAGTACAACATTGTGTACAACTCGATCGACCGATGTAACTTTAGCACG
CCTTTATACATCAGTAAAGGGAAGCCGAAAAGGACCCAAGTTATTATCGAGCGACCTATAGACTTTTCGACTGGT
AGAGCTGCTAGGTGGGCGAAAAGTGGAAGAGAAAGATGGCAGCAAAATCTATATGCTCAGCGTTGGAAGGGAGGA
GTCAAGGTTACAGTTCTGAGCAATGATATATATTAG
Gene >OphauG2|1057
ATGATTCTTTGTAGAGCCATCAGCTTCTTTCTGATTGCCACTGGGGTGAATGCCTCCGTATTCTCTGGTAAACAA
GGTCATCTGGATCTGGAATACATGATTAAAGCAACACACCAAGCTCGAGCCATTGTCTTGTATCTCAAAAGCTTT
GTCCGCGACCACATGCTACCACCACCCCATATCAACAAGAAACTTCCGACTCAAGGCCCATGTTTTTTCCAACAC
CAACCACTAGTCCCGGCTTCCGAGGCCATCGATATCCGAATAGTTGCTCACGAAGATGACGAGGTAATCACGGGA
TCACGCCCTGTGACAATAGAAATTAGGTCGTCCACCGCCCGCATCGATTCTTCGAAACTAGGCTGGAAAATGGAA
GATGAAGAACTCTCTTCAATAGAGCTCAGCGCTGGCGCCAGCGGGGCGGGCGTTGAAGTGTCGACTTCGGTATCT
ACTGGGACTAGAACTAACCTGGAAAAATCTGGTGAAAACGAGCTTCAGCAAGAGCATCAGATGGAGGTCAGCAAG
TCTTTTGAATGTTCGTCATATACTATTTGCACTGTTCAGACATGGACCTATGTTGCACAAATCCAGGGCACGTGC
CCTCGTGTTCCTATGATCGATGCAAAGTGTATTAAAGACGAGGCTTTGAAACAACTTTGCGCTGCAAACATGTTT
AATCCATCTTGCCCGCCTCCTCCGCCCATCGAATTGGATTTTTGGGAATCGATGGACTACATGATCTGGACTCGA
ACCAAGAGAAAACGATCGATGCAAACTCAGGGTATAGACATGATCCAATTCTATCAATCGCCATTATACCAAACT
CTCGAACGAAATTTATGGCATCACCGGAATATATCCCTTCCTTCAATCAATGACCAGTGGCCAGCATTTAATAAG
ATACAACAATTCTACTATAACATGACCAAGATGGACGGCTCACAAGCAGGCCAAGTACTTCCGGAAACATTGCGC
AACGGTATTTGGCGAGCCTCTGAGGACAAGTACAACATTGTGTACAACTCGATCGACCGATGTAACTTTAGCACG
CCTTTATACATCAGTAAAGGGAAGCCGAAAAGGACCCAAGTTATTATCGAGCGACCTATAGACTTTTCGACTGGT
AGAGCTGCTAGGTGGGCGAAAAGTGGAAGAGAAAGATGGCAGCAAAATCTATATGCTCAGCGTTGGAAGGGAGGA
GTCAAGGTTACAGTTCTGAGCAATGATATATATTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail