Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1054
Gene name
LocationContig_129:14589..15796
Strand-
Gene length (bp)1207
Transcript length (bp)1122
Coding sequence length (bp)1122
Protein length (aa) 374

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08243 SPT2 SPT2 chromatin protein 2.1E-13 271 360

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2782
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1054 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7183
Ophiocordyceps camponoti-floridani Ophcf2|06409
Ophiocordyceps camponoti-rufipedis Ophun1|3489
Ophiocordyceps kimflemingae Ophio5|6410
Ophiocordyceps subramaniannii Hirsu2|4442

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1054
MPIGDILDQISGQKATAGADSSTVAKRKPSSDLRGHVTKISRRGSPPPDPARPVSASTSRPANSLVSSSTPKTGA
RPLPPVSRGTPKPAAPRPVPRLPISKPTNSSTPNASPISKAPPKKGSYAEVLARAQRAQAVMGQVGKLQHKSIEK
GTLKAKKDEKPTVQVKNKSKLTSKTTPTYKGTSRAQSPLSKPVDDRSRDAGPRTNGMSRKNGRPTALTKPSALDH
DAACKTKFKKAAEATTGYTGTARPKTGVSKKSGPRGGALLKAPSGAKRSQNSYRDEQDDDMDDFIDDDDEIDQVE
LSYREKQYRYVESDDDESDMEVGLGELAVEERRAEKIARQEDIEEERLEKNLKMAKEEKKRKALEALRASRRR*
Coding >OphauG2|1054
ATGCCGATTGGAGATATCTTGGACCAGATCAGCGGGCAAAAGGCAACTGCCGGCGCCGACTCTTCCACAGTTGCC
AAGAGAAAACCGAGCAGCGACCTGCGTGGCCATGTGACGAAAATTTCTCGTCGAGGTAGTCCGCCGCCTGACCCG
GCTCGACCGGTATCGGCCTCGACCAGCCGCCCTGCAAATTCATTGGTGTCGTCTTCGACGCCCAAGACTGGCGCG
AGGCCGCTCCCTCCTGTATCGAGAGGCACGCCCAAGCCCGCGGCACCCCGGCCCGTGCCAAGACTGCCGATATCC
AAGCCCACAAACTCATCGACGCCCAATGCTTCGCCCATCTCCAAGGCGCCTCCGAAAAAGGGATCTTATGCCGAG
GTTCTCGCTCGTGCCCAGCGCGCCCAAGCCGTCATGGGCCAAGTTGGCAAACTTCAACACAAGTCGATTGAAAAG
GGAACCCTGAAAGCCAAGAAGGATGAAAAACCGACTGTACAAGTAAAGAACAAGTCCAAGTTGACGTCAAAAACT
ACCCCGACCTACAAAGGAACTTCTAGAGCGCAAAGTCCTCTCTCAAAACCGGTGGATGATCGATCTCGAGATGCA
GGCCCTCGTACCAACGGCATGAGTCGCAAAAACGGTCGACCAACAGCCTTGACCAAGCCGAGTGCATTGGACCAT
GACGCAGCTTGCAAAACAAAGTTCAAAAAGGCAGCTGAGGCCACTACAGGCTACACAGGAACTGCACGTCCCAAG
ACGGGTGTCTCGAAAAAGAGCGGTCCTCGCGGTGGTGCGCTTCTCAAGGCACCATCAGGTGCAAAGCGAAGCCAG
AACAGCTACCGGGACGAGCAAGACGATGATATGGACGATTTCATTGACGACGACGACGAAATCGATCAAGTCGAG
CTTTCATATCGAGAAAAACAGTATCGCTATGTCGAATCTGACGATGACGAATCGGATATGGAGGTTGGGCTAGGC
GAACTCGCCGTTGAAGAGCGTCGAGCGGAGAAGATTGCACGCCAGGAAGATATTGAGGAGGAACGGCTTGAAAAG
AACTTAAAAATGGCAAAGGAAGAGAAGAAACGAAAGGCTCTTGAAGCCCTGCGTGCGAGCAGACGACGATAG
Transcript >OphauG2|1054
ATGCCGATTGGAGATATCTTGGACCAGATCAGCGGGCAAAAGGCAACTGCCGGCGCCGACTCTTCCACAGTTGCC
AAGAGAAAACCGAGCAGCGACCTGCGTGGCCATGTGACGAAAATTTCTCGTCGAGGTAGTCCGCCGCCTGACCCG
GCTCGACCGGTATCGGCCTCGACCAGCCGCCCTGCAAATTCATTGGTGTCGTCTTCGACGCCCAAGACTGGCGCG
AGGCCGCTCCCTCCTGTATCGAGAGGCACGCCCAAGCCCGCGGCACCCCGGCCCGTGCCAAGACTGCCGATATCC
AAGCCCACAAACTCATCGACGCCCAATGCTTCGCCCATCTCCAAGGCGCCTCCGAAAAAGGGATCTTATGCCGAG
GTTCTCGCTCGTGCCCAGCGCGCCCAAGCCGTCATGGGCCAAGTTGGCAAACTTCAACACAAGTCGATTGAAAAG
GGAACCCTGAAAGCCAAGAAGGATGAAAAACCGACTGTACAAGTAAAGAACAAGTCCAAGTTGACGTCAAAAACT
ACCCCGACCTACAAAGGAACTTCTAGAGCGCAAAGTCCTCTCTCAAAACCGGTGGATGATCGATCTCGAGATGCA
GGCCCTCGTACCAACGGCATGAGTCGCAAAAACGGTCGACCAACAGCCTTGACCAAGCCGAGTGCATTGGACCAT
GACGCAGCTTGCAAAACAAAGTTCAAAAAGGCAGCTGAGGCCACTACAGGCTACACAGGAACTGCACGTCCCAAG
ACGGGTGTCTCGAAAAAGAGCGGTCCTCGCGGTGGTGCGCTTCTCAAGGCACCATCAGGTGCAAAGCGAAGCCAG
AACAGCTACCGGGACGAGCAAGACGATGATATGGACGATTTCATTGACGACGACGACGAAATCGATCAAGTCGAG
CTTTCATATCGAGAAAAACAGTATCGCTATGTCGAATCTGACGATGACGAATCGGATATGGAGGTTGGGCTAGGC
GAACTCGCCGTTGAAGAGCGTCGAGCGGAGAAGATTGCACGCCAGGAAGATATTGAGGAGGAACGGCTTGAAAAG
AACTTAAAAATGGCAAAGGAAGAGAAGAAACGAAAGGCTCTTGAAGCCCTGCGTGCGAGCAGACGACGATAG
Gene >OphauG2|1054
ATGCCGGTTTGTGGTTTTTTTTTTGGGGGGGATTTCTTTCTAAATCTCCTTACTCTGCGGGGGCTGGAGCTTCTG
ACAAAGATGACGGCAGATTGGAGATATCTTGGACCAGATCAGCGGGCAAAAGGCAACTGCCGGCGCCGACTCTTC
CACAGTTGCCAAGAGAAAACCGAGCAGCGACCTGCGTGGCCATGTGACGAAAATTTCTCGTCGAGGTAGTCCGCC
GCCTGACCCGGCTCGACCGGTATCGGCCTCGACCAGCCGCCCTGCAAATTCATTGGTGTCGTCTTCGACGCCCAA
GACTGGCGCGAGGCCGCTCCCTCCTGTATCGAGAGGCACGCCCAAGCCCGCGGCACCCCGGCCCGTGCCAAGACT
GCCGATATCCAAGCCCACAAACTCATCGACGCCCAATGCTTCGCCCATCTCCAAGGCGCCTCCGAAAAAGGGATC
TTATGCCGAGGTTCTCGCTCGTGCCCAGCGCGCCCAAGCCGTCATGGGCCAAGTTGGCAAACTTCAACACAAGTC
GATTGAAAAGGGAACCCTGAAAGCCAAGAAGGATGAAAAACCGACTGTACAAGTAAAGAACAAGTCCAAGTTGAC
GTCAAAAACTACCCCGACCTACAAAGGAACTTCTAGAGCGCAAAGTCCTCTCTCAAAACCGGTGGATGATCGATC
TCGAGATGCAGGCCCTCGTACCAACGGCATGAGTCGCAAAAACGGTCGACCAACAGCCTTGACCAAGCCGAGTGC
ATTGGACCATGACGCAGCTTGCAAAACAAAGTTCAAAAAGGCAGCTGAGGCCACTACAGGCTACACAGGAACTGC
ACGTCCCAAGACGGGTGTCTCGAAAAAGAGCGGTCCTCGCGGTGGTGCGCTTCTCAAGGCACCATCAGGTGCAAA
GCGAAGCCAGAACAGCTACCGGGACGAGCAAGACGATGATATGGACGATTTCATTGACGACGACGACGAAATCGA
TCAAGTCGAGCTTTCATATCGAGAAAAACAGTATCGCTATGTCGAATCTGACGATGACGAATCGGATATGGAGGT
TGGGCTAGGCGAACTCGCCGTTGAAGAGCGTCGAGCGGAGAAGATTGCACGCCAGGAAGATATTGAGGAGGAACG
GCTTGAAAAGAACTTAAAAATGGCAAAGGAAGAGAAGAAACGAAAGGCTCTTGAAGCCCTGCGTGCGAGCAGACG
ACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail