Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1053
Gene name
LocationContig_129:11656..13560
Strand+
Gene length (bp)1904
Transcript length (bp)1656
Coding sequence length (bp)1656
Protein length (aa) 552

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10453 NUFIP1 Nuclear fragile X mental retardation-interacting protein 1 (NUFIP1) 3.5E-05 277 298

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2783
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1053 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7182
Ophiocordyceps camponoti-floridani Ophcf2|06410
Ophiocordyceps camponoti-rufipedis Ophun1|3490
Ophiocordyceps kimflemingae Ophio5|6411
Ophiocordyceps subramaniannii Hirsu2|4443

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1053
MSGYGYAPPPPPPPGGVYAQPTVAFGHHGPPRGPPTHGYDYAQQYAPPHGAPYQSHPSTMAYQPHHSQSWTGDHA
SMPHHSNAHSSNAPVPISPSSYHTNYAPPSFASQYPQQPSYDAHFTNPYNSPPPHWPSQGPPQHGHYVASRGRGA
YGDRGGSKLPAHTYDHEQAAMVVSRHEGRHSHFQRRGRGGPRDSFRGRGGHNHGGDRSRNQPNHSKQEPKIKAES
PSVGKKKKRRTNTLGLTPGMDSETEDDEGEEKALLELIGSEALRVTDMTIFLAERRKNYPTTARVEAKKAAELAQ
LDKEKAELLEKQADRLRRQLRKVESSIKRKRDQGDEGDEMRESSQDQSDDDMPEVMSSRSEALVSLSQPKAKRAD
VTRHCKYFSTGGTCGKKGKCRFVHDVQERERAIKERQANDGRMTIQQRLILNDKEQEDLTILQSIQYLREKGVMV
SSSNSLVSNDDKGDAMDCVVKEEKQTHRKATSGPSLLPAAPASLPEPPIRKEAGSSRRISSQPVLPRANSVGRQP
SEHYQGWLLKPYGSSNGTQSLSDDLP*
Coding >OphauG2|1053
ATGTCGGGCTACGGCTACGCACCGCCGCCGCCGCCGCCGCCAGGTGGTGTCTATGCTCAGCCGACTGTCGCGTTT
GGCCATCATGGCCCTCCTCGAGGTCCCCCGACACATGGCTATGACTACGCTCAGCAGTATGCGCCACCCCACGGT
GCACCCTACCAGTCGCATCCCTCAACAATGGCCTACCAGCCTCATCATTCCCAGTCGTGGACTGGCGATCATGCT
TCCATGCCTCATCACTCCAACGCCCATTCTTCTAATGCGCCTGTCCCCATCTCTCCGTCCAGCTATCATACAAAC
TACGCTCCTCCTTCGTTTGCTTCTCAGTATCCGCAACAGCCCTCATACGATGCTCACTTTACAAACCCGTATAAC
TCCCCTCCGCCACATTGGCCTTCGCAAGGCCCTCCTCAGCATGGCCATTATGTCGCTAGCAGAGGCCGAGGAGCC
TACGGAGACCGAGGTGGCTCCAAGCTCCCTGCTCATACCTATGACCATGAGCAAGCAGCCATGGTTGTTTCCCGT
CATGAGGGGCGTCATAGTCACTTTCAACGCCGTGGCCGTGGTGGGCCTCGCGATAGCTTTCGCGGACGTGGCGGT
CATAATCATGGAGGAGATAGATCGCGCAATCAGCCAAACCATTCCAAGCAAGAGCCTAAAATTAAGGCTGAATCT
CCTTCTGTCGGCAAGAAGAAGAAGCGCAGGACCAATACCCTTGGCCTCACACCTGGCATGGACTCGGAAACCGAA
GACGATGAAGGAGAGGAGAAAGCTCTGCTTGAACTGATTGGCTCTGAAGCCTTGCGTGTCACCGACATGACTATT
TTCTTGGCCGAGCGGCGCAAGAATTACCCCACCACGGCGCGTGTCGAAGCCAAAAAGGCTGCCGAGCTGGCACAA
TTGGACAAGGAAAAGGCCGAATTGCTCGAAAAGCAAGCCGATAGGCTGCGCAGACAGCTCCGCAAAGTTGAGTCA
TCGATCAAGCGAAAGCGAGACCAGGGAGATGAAGGGGATGAGATGCGGGAATCTTCACAAGATCAGTCTGATGAC
GACATGCCCGAAGTTATGTCTTCCCGAAGTGAGGCCCTCGTGTCCCTTTCTCAACCCAAGGCCAAGAGGGCCGAT
GTAACGAGGCATTGCAAGTATTTCTCTACGGGAGGAACTTGCGGCAAAAAGGGCAAGTGCCGCTTCGTGCATGAT
GTGCAGGAGAGAGAGAGGGCTATCAAGGAGCGCCAGGCAAACGACGGCCGCATGACGATACAGCAGCGTCTGATC
CTCAACGATAAGGAACAAGAGGACTTGACAATTCTTCAGTCCATTCAATACCTGCGCGAAAAGGGCGTCATGGTG
TCGTCGTCAAATTCCTTGGTCAGCAACGATGACAAAGGTGATGCCATGGATTGCGTGGTCAAAGAGGAGAAGCAG
ACGCACAGAAAGGCAACTTCTGGACCTAGTCTACTACCAGCTGCACCCGCGTCTCTTCCCGAGCCGCCCATCAGG
AAAGAGGCTGGTTCGTCGCGCAGGATCTCCTCGCAGCCCGTTCTCCCGCGCGCCAATAGTGTGGGCCGTCAGCCT
TCGGAACACTATCAAGGCTGGCTGCTCAAGCCATACGGAAGCTCCAACGGCACACAGTCTCTAAGCGATGACTTG
CCATAG
Transcript >OphauG2|1053
ATGTCGGGCTACGGCTACGCACCGCCGCCGCCGCCGCCGCCAGGTGGTGTCTATGCTCAGCCGACTGTCGCGTTT
GGCCATCATGGCCCTCCTCGAGGTCCCCCGACACATGGCTATGACTACGCTCAGCAGTATGCGCCACCCCACGGT
GCACCCTACCAGTCGCATCCCTCAACAATGGCCTACCAGCCTCATCATTCCCAGTCGTGGACTGGCGATCATGCT
TCCATGCCTCATCACTCCAACGCCCATTCTTCTAATGCGCCTGTCCCCATCTCTCCGTCCAGCTATCATACAAAC
TACGCTCCTCCTTCGTTTGCTTCTCAGTATCCGCAACAGCCCTCATACGATGCTCACTTTACAAACCCGTATAAC
TCCCCTCCGCCACATTGGCCTTCGCAAGGCCCTCCTCAGCATGGCCATTATGTCGCTAGCAGAGGCCGAGGAGCC
TACGGAGACCGAGGTGGCTCCAAGCTCCCTGCTCATACCTATGACCATGAGCAAGCAGCCATGGTTGTTTCCCGT
CATGAGGGGCGTCATAGTCACTTTCAACGCCGTGGCCGTGGTGGGCCTCGCGATAGCTTTCGCGGACGTGGCGGT
CATAATCATGGAGGAGATAGATCGCGCAATCAGCCAAACCATTCCAAGCAAGAGCCTAAAATTAAGGCTGAATCT
CCTTCTGTCGGCAAGAAGAAGAAGCGCAGGACCAATACCCTTGGCCTCACACCTGGCATGGACTCGGAAACCGAA
GACGATGAAGGAGAGGAGAAAGCTCTGCTTGAACTGATTGGCTCTGAAGCCTTGCGTGTCACCGACATGACTATT
TTCTTGGCCGAGCGGCGCAAGAATTACCCCACCACGGCGCGTGTCGAAGCCAAAAAGGCTGCCGAGCTGGCACAA
TTGGACAAGGAAAAGGCCGAATTGCTCGAAAAGCAAGCCGATAGGCTGCGCAGACAGCTCCGCAAAGTTGAGTCA
TCGATCAAGCGAAAGCGAGACCAGGGAGATGAAGGGGATGAGATGCGGGAATCTTCACAAGATCAGTCTGATGAC
GACATGCCCGAAGTTATGTCTTCCCGAAGTGAGGCCCTCGTGTCCCTTTCTCAACCCAAGGCCAAGAGGGCCGAT
GTAACGAGGCATTGCAAGTATTTCTCTACGGGAGGAACTTGCGGCAAAAAGGGCAAGTGCCGCTTCGTGCATGAT
GTGCAGGAGAGAGAGAGGGCTATCAAGGAGCGCCAGGCAAACGACGGCCGCATGACGATACAGCAGCGTCTGATC
CTCAACGATAAGGAACAAGAGGACTTGACAATTCTTCAGTCCATTCAATACCTGCGCGAAAAGGGCGTCATGGTG
TCGTCGTCAAATTCCTTGGTCAGCAACGATGACAAAGGTGATGCCATGGATTGCGTGGTCAAAGAGGAGAAGCAG
ACGCACAGAAAGGCAACTTCTGGACCTAGTCTACTACCAGCTGCACCCGCGTCTCTTCCCGAGCCGCCCATCAGG
AAAGAGGCTGGTTCGTCGCGCAGGATCTCCTCGCAGCCCGTTCTCCCGCGCGCCAATAGTGTGGGCCGTCAGCCT
TCGGAACACTATCAAGGCTGGCTGCTCAAGCCATACGGAAGCTCCAACGGCACACAGTCTCTAAGCGATGACTTG
CCATAG
Gene >OphauG2|1053
ATGTCGGGCTACGGCTACGCACCGCCGCCGCCGCCGCCGCCAGGTGGTGTCTATGCTCAGCCGACTGTCGCGTTT
GGCCATCATGGCCCTCCTCGAGGTGCAGCAACGTCTGGCTCGCGTGGCCGCGGAGGGCAGTATCCTCGTGGTCGG
GCTGATTACCGCCCTGCTACAGGTCCCCCGACACATGGCTATGACTACGCTCAGCAGTATGCGCCACCCCACGGT
GCACCCTACCAGTCGCATCCCTCAACAATGGCCTACCAGCCTCATCATTCCCAGTCGTGGACTGGCGATCATGCT
TCCATGCCTCATCACTCCAACGCCCATTCTTCTAATGCGCCTGTCCCCATCTCTCCGTCCAGCTATCATACAAAC
TACGCTCCTCCTTCGTTTGCTTCTCAGTATCCGCAACAGCCCTCATACGATGCTCACTTTACAAACCCGTATAAC
TCCCCTCCGCCACATTGGCCTTCGCAAGGCCCTCCTCAGCATGGCCATTATGTCGCTAGCAGAGGCCGAGGAGCC
TACGGAGACCGAGGTGGCTCCAAGCTCCCTGCTCATACCTATGACCATGAGCAAGCAGCCATGGTTGGTGCGTTT
GGTCAGCATTATTCCCCTCACCCGGGTCCTCGCCCCGCTCACTACCCTCATGCCCAATATCCATTCGTTGGACCC
TCCATGTCTGCACCAGTTTCCCGTCATGAGGGGCGTCATAGTCACTTTCAACGCCGTGGCCGTGGTGGGCCTCGC
GATAGCTTTCGCGGACGTGGCGGTCATAATCATGGAGGAGATAGATCGCGCAATCAGCCAAACCATTCCAAGCAA
GAGCCTAAAATTAAGGCTGAATCTCCTTCTGTCGGCAAGAAGAAGAAGCGCAGGACCAATACCCTTGGCCTCACA
CCTGGCATGGACTCGGAAACCGAAGACGATGAAGGAGAGGAGAAAGCTCTGCTTGAACTGATTGGCTCTGAAGCC
TTGCGGTAAGCTTGTTTACCGCAACGAGACCATTGCCTTACTGACAAATCCCCCCTCCCCCCTCCCCCAAAAAAA
ATAGTGTCACCGACATGACTATTTTCTTGGCCGAGCGGCGCAAGAATTACCCCACCACGGCGCGTGTCGAAGCCA
AAAAGGCTGCCGAGCTGGCACAATTGGACAAGGAAAAGGCCGAATTGCTCGAAAAGCAAGCCGATAGGCTGCGCA
GACAGCTCCGCAAAGTTGAGTCATCGATCAAGCGAAAGCGAGACCAGGGAGATGAAGGGGATGAGATGCGGGAAT
CTTCACAAGATCAGTCTGATGACGACATGCCCGAAGTTATGTCTTCCCGAAGTGAGGCCCTCGTGTCCCTTTCTC
AACCCAAGGCCAAGAGGGCCGATGTAACGAGGCATTGCAAGTATTTCTCTACGGGAGGAACTTGCGGCAAAAAGG
GCAAGTGCCGCTTCGTGCATGATGTGCAGGAGAGAGAGAGGGCTATCAAGGAGCGCCAGGCAAACGACGGCCGCA
TGACGATACAGCAGCGTCTGATCCTCAACGATAAGGAACAAGAGGACTTGACAATTCTTCAGTCCATTCAATACC
TGCGCGAAAAGGGCGTCATGGTGTCGTCGTCAAATTCCTTGGTCAGCAACGATGACAAAGGTGATGCCATGGATT
GCGTGGTCAAAGAGGAGAAGCAGACGCACAGAAAGGCAACTTCTGGACCTAGTCTACTACCAGCTGCACCCGCGT
CTCTTCCCGAGCCGCCCATCAGGAAAGAGGCTGGTTCGTCGCGCAGGATCTCCTCGCAGCCCGTTCTCCCGCGCG
CCAATAGTGTGGGCCGTCAGCCTTCGGAACACTATCAAGGCTGGCTGCTCAAGCCATACGGAAGCTCCAACGGCA
CACAGTCTCTAAGCGATGACTTGCCATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail