Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1035
Gene name
LocationContig_1282:181..538
Strand+
Gene length (bp)357
Transcript length (bp)357
Coding sequence length (bp)357
Protein length (aa) 119

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03142 Chitin_synth_2 Chitin synthase 5.5E-29 1 66

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 113 4.0E-43
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1 88 3.0E-38
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 1 70 2.0E-31
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 71 5.0E-24
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 66 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13353|CHS4_MAGO7 Chitin synthase 4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=CHS4 PE=3 SV=2 1 113 4.0E-43
sp|Q01285|CHS4_NEUCR Chitin synthase 4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=chs-4 PE=3 SV=3 1 88 3.0E-38
sp|P78611|CHSD_EMENI Chitin synthase D OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=chsD PE=3 SV=4 1 70 2.0E-31
sp|J9VXM5|CHS3_CRYNH Chitin synthase 3 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS3 PE=3 SV=1 1 71 5.0E-24
sp|P29465|CHS3_YEAST Chitin synthase 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHS3 PE=1 SV=3 1 66 2.0E-23
sp|O13394|CHS5_USTMA Chitin synthase 5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS5 PE=3 SV=3 1 68 1.0E-22
sp|O13356|CHS1_CRYNH Chitin synthase 1 OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CHS1 PE=3 SV=2 1 65 1.0E-19
sp|P30573|CHS3_CANAX Chitin synthase 3 OS=Candida albicans GN=CHS3 PE=3 SV=1 2 58 3.0E-18
sp|Q4P333|CHS7_USTMA Chitin synthase 7 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS7 PE=3 SV=1 1 65 1.0E-17
sp|Q4P9K9|CHS8_USTMA Chitin synthase 8 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS8 PE=3 SV=1 1 100 3.0E-15
sp|Q8SSI7|CHS1_ENCCU Chitin synthase 1 OS=Encephalitozoon cuniculi (strain GB-M1) GN=CHS1 PE=2 SV=1 2 63 5.0E-15
sp|O13395|CHS6_USTMA Chitin synthase 6 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=CHS6 PE=3 SV=2 1 66 2.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1035
MLIYLLSLPIWNFVLPTYAFWKFDDFSWGDTRKTAGDEATKGRIEHQGEFDSSKITMKRWAEFERDKRSRTSYWG
SRENVVGGGAGASSNPAAAATWALPLGHDHLQSQDYHHHLAEA*
Coding >OphauG2|1035
ATGCTCATCTATCTGCTTTCACTACCCATTTGGAACTTTGTCCTGCCGACGTATGCCTTTTGGAAGTTTGACGAC
TTTTCCTGGGGCGACACTCGTAAGACGGCCGGCGACGAGGCTACCAAAGGACGAATCGAGCACCAGGGCGAGTTT
GATAGCAGCAAGATTACCATGAAGCGATGGGCCGAATTTGAGCGCGATAAGCGTTCCCGCACCAGCTACTGGGGC
TCGAGAGAAAATGTCGTCGGAGGGGGAGCGGGAGCGAGCAGCAATCCCGCTGCTGCTGCTACCTGGGCCTTGCCT
CTAGGACACGACCATTTACAGAGCCAAGACTATCATCATCACCTTGCAGAGGCCTAA
Transcript >OphauG2|1035
ATGCTCATCTATCTGCTTTCACTACCCATTTGGAACTTTGTCCTGCCGACGTATGCCTTTTGGAAGTTTGACGAC
TTTTCCTGGGGCGACACTCGTAAGACGGCCGGCGACGAGGCTACCAAAGGACGAATCGAGCACCAGGGCGAGTTT
GATAGCAGCAAGATTACCATGAAGCGATGGGCCGAATTTGAGCGCGATAAGCGTTCCCGCACCAGCTACTGGGGC
TCGAGAGAAAATGTCGTCGGAGGGGGAGCGGGAGCGAGCAGCAATCCCGCTGCTGCTGCTACCTGGGCCTTGCCT
CTAGGACACGACCATTTACAGAGCCAAGACTATCATCATCACCTTGCAGAGGCCTAA
Gene >OphauG2|1035
ATGCTCATCTATCTGCTTTCACTACCCATTTGGAACTTTGTCCTGCCGACGTATGCCTTTTGGAAGTTTGACGAC
TTTTCCTGGGGCGACACTCGTAAGACGGCCGGCGACGAGGCTACCAAAGGACGAATCGAGCACCAGGGCGAGTTT
GATAGCAGCAAGATTACCATGAAGCGATGGGCCGAATTTGAGCGCGATAAGCGTTCCCGCACCAGCTACTGGGGC
TCGAGAGAAAATGTCGTCGGAGGGGGAGCGGGAGCGAGCAGCAATCCCGCTGCTGCTGCTACCTGGGCCTTGCCT
CTAGGACACGACCATTTACAGAGCCAAGACTATCATCATCACCTTGCAGAGGCCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail