Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1029
Gene name
LocationContig_128:19975..21703
Strand+
Gene length (bp)1728
Transcript length (bp)1728
Coding sequence length (bp)1728
Protein length (aa) 576

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999715

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup121
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1029 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|161
Ophiocordyceps camponoti-floridani Ophcf2|02222
Ophiocordyceps camponoti-rufipedis Ophun1|2938
Ophiocordyceps kimflemingae Ophio5|3458
Ophiocordyceps subramaniannii Hirsu2|10002
Ophiocordyceps subramaniannii Hirsu2|23
Ophiocordyceps subramaniannii Hirsu2|431
Ophiocordyceps subramaniannii Hirsu2|4496
Ophiocordyceps subramaniannii Hirsu2|5356
Ophiocordyceps subramaniannii Hirsu2|8076

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1029
MMLSCLVLYGLLLVPVSALSESRRHNTTQLFIDNLQRNVRIDWNTPPRAYIDGQFEKSCPNWAFTCWYVGFSIRK
LLVDKYLFDPFNKTKIVSRPNISIYYNPLVEKSVVNMGDDDLSMSVEESKTSIDSTTKGWQIGAQISLGAGQGVS
ASVGVSGSYSSSQTTGNWDTKGVSVSSVCKPGHDCRIETWTFHLKIEGHCRIEPIVNCAGPMDPCRRDWSQTCQQ
FEDYRHRHCLTNDDAVEPYKYEPCEVTTPVLDQAGRPFTRIVRISQDIASVHDEAKKQGERIAKAVKKYSDYYKL
DNGKYYNEENDMWWNFASQSWVRVKGRPKPDLSRFKGKAKPRGSGKEHGEKKGKAVPKAVKMVDDWFLLDNGARY
KRPNLWWDFEGQVWVSRNDVWVPDLSGFTDRHGAKGSWPDKALQDTDKRLALRVVGKGKDWYQLEDCMWYDKETD
EIWSGHDGGWFKRPAVLLVPDTSEFDRLHKAGDVSNLYDSGSDDAGAHAGGQDDAEPPARATSRAHGGDKAGKVK
RSSMSRAPRHGKFGADATFSTQLQASARAADIEVTFVDDLPDNLFGANQG*
Coding >OphauG2|1029
ATGATGCTGTCATGTCTTGTCTTATACGGCCTCCTACTTGTGCCCGTGTCGGCGCTTTCTGAGTCTCGGAGGCAC
AATACGACCCAGTTATTCATTGACAACCTTCAGCGTAACGTCAGAATTGACTGGAACACGCCCCCGAGAGCCTAC
ATAGACGGGCAATTTGAAAAAAGCTGTCCCAATTGGGCCTTTACCTGCTGGTATGTCGGCTTCAGTATCCGCAAA
CTGCTAGTCGATAAGTATCTCTTTGATCCATTCAACAAGACCAAAATCGTGTCAAGACCAAATATCAGCATCTAC
TACAATCCCCTGGTGGAGAAGAGCGTCGTCAACATGGGCGACGACGACCTCTCCATGTCGGTTGAAGAATCCAAG
ACGTCCATCGACAGCACCACCAAGGGATGGCAGATTGGAGCGCAAATATCCCTCGGAGCCGGCCAAGGCGTGTCA
GCCAGCGTTGGCGTCTCTGGGAGCTACTCGTCGTCTCAAACTACGGGCAATTGGGATACCAAGGGAGTTTCGGTA
TCTTCAGTGTGCAAACCTGGACACGACTGCCGCATCGAGACTTGGACCTTTCATCTCAAGATTGAGGGCCACTGT
CGCATCGAGCCCATTGTCAACTGTGCTGGACCCATGGATCCTTGCAGACGAGACTGGTCCCAGACCTGTCAGCAG
TTTGAGGACTATCGGCATAGGCACTGCCTGACCAACGACGATGCCGTTGAACCATATAAATACGAACCCTGTGAG
GTGACGACGCCGGTCCTGGACCAGGCTGGCAGACCTTTTACTCGAATCGTGCGCATTTCGCAGGATATTGCCAGC
GTCCACGACGAAGCCAAAAAACAGGGGGAAAGGATAGCCAAGGCTGTGAAAAAATATAGCGACTATTACAAACTT
GACAATGGGAAATATTACAACGAGGAAAACGATATGTGGTGGAACTTTGCCTCTCAAAGCTGGGTTCGTGTCAAG
GGACGGCCAAAGCCCGACTTGTCCAGATTCAAGGGCAAGGCAAAGCCCCGAGGCAGCGGCAAGGAGCACGGCGAG
AAGAAGGGCAAGGCGGTGCCCAAGGCCGTCAAGATGGTAGACGACTGGTTCCTGTTGGACAATGGGGCGCGGTAC
AAGCGCCCCAACTTGTGGTGGGACTTTGAGGGGCAAGTGTGGGTTAGCAGAAACGACGTCTGGGTGCCGGACCTG
TCGGGTTTTACGGACAGGCACGGGGCAAAAGGCTCGTGGCCGGACAAGGCACTCCAAGACACAGACAAGAGGCTG
GCGCTTCGCGTGGTTGGAAAAGGCAAAGACTGGTACCAGCTCGAGGACTGCATGTGGTACGACAAGGAGACTGAT
GAGATCTGGTCGGGGCATGACGGCGGGTGGTTCAAGAGGCCGGCTGTGTTGCTCGTTCCCGACACGTCCGAGTTT
GACCGACTGCACAAAGCCGGAGACGTCAGCAACCTGTACGACAGTGGCAGTGATGACGCTGGAGCGCATGCGGGC
GGGCAAGATGACGCGGAGCCACCAGCCAGGGCAACAAGCAGAGCGCATGGTGGGGACAAGGCAGGCAAAGTCAAA
AGATCCAGCATGAGCAGGGCGCCTCGTCATGGCAAGTTTGGCGCCGACGCCACTTTTTCCACTCAGTTGCAGGCT
TCCGCCAGGGCGGCAGACATCGAGGTTACATTTGTCGACGATCTACCGGACAACTTGTTTGGTGCAAACCAAGGG
TAG
Transcript >OphauG2|1029
ATGATGCTGTCATGTCTTGTCTTATACGGCCTCCTACTTGTGCCCGTGTCGGCGCTTTCTGAGTCTCGGAGGCAC
AATACGACCCAGTTATTCATTGACAACCTTCAGCGTAACGTCAGAATTGACTGGAACACGCCCCCGAGAGCCTAC
ATAGACGGGCAATTTGAAAAAAGCTGTCCCAATTGGGCCTTTACCTGCTGGTATGTCGGCTTCAGTATCCGCAAA
CTGCTAGTCGATAAGTATCTCTTTGATCCATTCAACAAGACCAAAATCGTGTCAAGACCAAATATCAGCATCTAC
TACAATCCCCTGGTGGAGAAGAGCGTCGTCAACATGGGCGACGACGACCTCTCCATGTCGGTTGAAGAATCCAAG
ACGTCCATCGACAGCACCACCAAGGGATGGCAGATTGGAGCGCAAATATCCCTCGGAGCCGGCCAAGGCGTGTCA
GCCAGCGTTGGCGTCTCTGGGAGCTACTCGTCGTCTCAAACTACGGGCAATTGGGATACCAAGGGAGTTTCGGTA
TCTTCAGTGTGCAAACCTGGACACGACTGCCGCATCGAGACTTGGACCTTTCATCTCAAGATTGAGGGCCACTGT
CGCATCGAGCCCATTGTCAACTGTGCTGGACCCATGGATCCTTGCAGACGAGACTGGTCCCAGACCTGTCAGCAG
TTTGAGGACTATCGGCATAGGCACTGCCTGACCAACGACGATGCCGTTGAACCATATAAATACGAACCCTGTGAG
GTGACGACGCCGGTCCTGGACCAGGCTGGCAGACCTTTTACTCGAATCGTGCGCATTTCGCAGGATATTGCCAGC
GTCCACGACGAAGCCAAAAAACAGGGGGAAAGGATAGCCAAGGCTGTGAAAAAATATAGCGACTATTACAAACTT
GACAATGGGAAATATTACAACGAGGAAAACGATATGTGGTGGAACTTTGCCTCTCAAAGCTGGGTTCGTGTCAAG
GGACGGCCAAAGCCCGACTTGTCCAGATTCAAGGGCAAGGCAAAGCCCCGAGGCAGCGGCAAGGAGCACGGCGAG
AAGAAGGGCAAGGCGGTGCCCAAGGCCGTCAAGATGGTAGACGACTGGTTCCTGTTGGACAATGGGGCGCGGTAC
AAGCGCCCCAACTTGTGGTGGGACTTTGAGGGGCAAGTGTGGGTTAGCAGAAACGACGTCTGGGTGCCGGACCTG
TCGGGTTTTACGGACAGGCACGGGGCAAAAGGCTCGTGGCCGGACAAGGCACTCCAAGACACAGACAAGAGGCTG
GCGCTTCGCGTGGTTGGAAAAGGCAAAGACTGGTACCAGCTCGAGGACTGCATGTGGTACGACAAGGAGACTGAT
GAGATCTGGTCGGGGCATGACGGCGGGTGGTTCAAGAGGCCGGCTGTGTTGCTCGTTCCCGACACGTCCGAGTTT
GACCGACTGCACAAAGCCGGAGACGTCAGCAACCTGTACGACAGTGGCAGTGATGACGCTGGAGCGCATGCGGGC
GGGCAAGATGACGCGGAGCCACCAGCCAGGGCAACAAGCAGAGCGCATGGTGGGGACAAGGCAGGCAAAGTCAAA
AGATCCAGCATGAGCAGGGCGCCTCGTCATGGCAAGTTTGGCGCCGACGCCACTTTTTCCACTCAGTTGCAGGCT
TCCGCCAGGGCGGCAGACATCGAGGTTACATTTGTCGACGATCTACCGGACAACTTGTTTGGTGCAAACCAAGGG
TAG
Gene >OphauG2|1029
ATGATGCTGTCATGTCTTGTCTTATACGGCCTCCTACTTGTGCCCGTGTCGGCGCTTTCTGAGTCTCGGAGGCAC
AATACGACCCAGTTATTCATTGACAACCTTCAGCGTAACGTCAGAATTGACTGGAACACGCCCCCGAGAGCCTAC
ATAGACGGGCAATTTGAAAAAAGCTGTCCCAATTGGGCCTTTACCTGCTGGTATGTCGGCTTCAGTATCCGCAAA
CTGCTAGTCGATAAGTATCTCTTTGATCCATTCAACAAGACCAAAATCGTGTCAAGACCAAATATCAGCATCTAC
TACAATCCCCTGGTGGAGAAGAGCGTCGTCAACATGGGCGACGACGACCTCTCCATGTCGGTTGAAGAATCCAAG
ACGTCCATCGACAGCACCACCAAGGGATGGCAGATTGGAGCGCAAATATCCCTCGGAGCCGGCCAAGGCGTGTCA
GCCAGCGTTGGCGTCTCTGGGAGCTACTCGTCGTCTCAAACTACGGGCAATTGGGATACCAAGGGAGTTTCGGTA
TCTTCAGTGTGCAAACCTGGACACGACTGCCGCATCGAGACTTGGACCTTTCATCTCAAGATTGAGGGCCACTGT
CGCATCGAGCCCATTGTCAACTGTGCTGGACCCATGGATCCTTGCAGACGAGACTGGTCCCAGACCTGTCAGCAG
TTTGAGGACTATCGGCATAGGCACTGCCTGACCAACGACGATGCCGTTGAACCATATAAATACGAACCCTGTGAG
GTGACGACGCCGGTCCTGGACCAGGCTGGCAGACCTTTTACTCGAATCGTGCGCATTTCGCAGGATATTGCCAGC
GTCCACGACGAAGCCAAAAAACAGGGGGAAAGGATAGCCAAGGCTGTGAAAAAATATAGCGACTATTACAAACTT
GACAATGGGAAATATTACAACGAGGAAAACGATATGTGGTGGAACTTTGCCTCTCAAAGCTGGGTTCGTGTCAAG
GGACGGCCAAAGCCCGACTTGTCCAGATTCAAGGGCAAGGCAAAGCCCCGAGGCAGCGGCAAGGAGCACGGCGAG
AAGAAGGGCAAGGCGGTGCCCAAGGCCGTCAAGATGGTAGACGACTGGTTCCTGTTGGACAATGGGGCGCGGTAC
AAGCGCCCCAACTTGTGGTGGGACTTTGAGGGGCAAGTGTGGGTTAGCAGAAACGACGTCTGGGTGCCGGACCTG
TCGGGTTTTACGGACAGGCACGGGGCAAAAGGCTCGTGGCCGGACAAGGCACTCCAAGACACAGACAAGAGGCTG
GCGCTTCGCGTGGTTGGAAAAGGCAAAGACTGGTACCAGCTCGAGGACTGCATGTGGTACGACAAGGAGACTGAT
GAGATCTGGTCGGGGCATGACGGCGGGTGGTTCAAGAGGCCGGCTGTGTTGCTCGTTCCCGACACGTCCGAGTTT
GACCGACTGCACAAAGCCGGAGACGTCAGCAACCTGTACGACAGTGGCAGTGATGACGCTGGAGCGCATGCGGGC
GGGCAAGATGACGCGGAGCCACCAGCCAGGGCAACAAGCAGAGCGCATGGTGGGGACAAGGCAGGCAAAGTCAAA
AGATCCAGCATGAGCAGGGCGCCTCGTCATGGCAAGTTTGGCGCCGACGCCACTTTTTCCACTCAGTTGCAGGCT
TCCGCCAGGGCGGCAGACATCGAGGTTACATTTGTCGACGATCTACCGGACAACTTGTTTGGTGCAAACCAAGGG
TAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail