Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1021
Gene name
LocationContig_128:60..884
Strand-
Gene length (bp)824
Transcript length (bp)753
Coding sequence length (bp)753
Protein length (aa) 251

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05721 PhyH Phytanoyl-CoA dioxygenase (PhyH) 5.2E-41 13 244

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5SRE7|PHYD1_HUMAN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens GN=PHYHD1 PE=1 SV=2 5 249 5.0E-43
sp|Q0IIB1|PHYD1_BOVIN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Bos taurus GN=PHYHD1 PE=2 SV=1 5 249 2.0E-41
sp|Q9DB26|PHYD1_MOUSE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Mus musculus GN=Phyhd1 PE=1 SV=2 5 242 6.0E-40
sp|P0C660|PHYD1_CAEBR Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis briggsae GN=CBG00325 PE=3 SV=1 13 242 8.0E-40
sp|Q9NAM7|PHYD1_CAEEL Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=Y105C5B.9 PE=3 SV=1 13 232 8.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5SRE7|PHYD1_HUMAN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Homo sapiens GN=PHYHD1 PE=1 SV=2 5 249 5.0E-43
sp|Q0IIB1|PHYD1_BOVIN Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Bos taurus GN=PHYHD1 PE=2 SV=1 5 249 2.0E-41
sp|Q9DB26|PHYD1_MOUSE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Mus musculus GN=Phyhd1 PE=1 SV=2 5 242 6.0E-40
sp|P0C660|PHYD1_CAEBR Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis briggsae GN=CBG00325 PE=3 SV=1 13 242 8.0E-40
sp|Q9NAM7|PHYD1_CAEEL Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=Y105C5B.9 PE=3 SV=1 13 232 8.0E-40
sp|Q5BJP9|PHYD1_RAT Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Rattus norvegicus GN=Phyhd1 PE=2 SV=1 5 242 8.0E-40
sp|Q5U3U0|PHYD1_DANRE Phytanoyl-CoA dioxygenase domain-containing protein 1 OS=Danio rerio GN=phyhd1 PE=2 SV=1 5 249 7.0E-39
sp|Q9ZVF6|PAHX_ARATH Phytanoyl-CoA dioxygenase OS=Arabidopsis thaliana GN=PAHX PE=2 SV=2 9 246 5.0E-34
sp|Q65WW7|PAHX2_ORYSJ Phytanoyl-CoA dioxygenase 2 OS=Oryza sativa subsp. japonica GN=Os05g0473900 PE=2 SV=1 2 242 2.0E-32
sp|Q10E49|PAHX1_ORYSJ Phytanoyl-CoA dioxygenase 1 OS=Oryza sativa subsp. japonica GN=Os03g0708100 PE=2 SV=1 2 242 2.0E-32
sp|Q54XH6|PHYD1_DICDI Phytanoyl-CoA dioxygenase domain-containing protein 1 homolog OS=Dictyostelium discoideum GN=phyhd1 PE=3 SV=1 5 231 6.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1021
MAKGLDSAQVAAFERDGYLVIPGALSASSVANLLSETQRLLGDFSLDEHPLTRFTTGQGSTGEHIGDEYFLSSGD
KVRFFFEEDAFDEQGRLVRDKERAVNKIGHGLHMQKGPFGALLQGAGGEVASGHEDIQTAPVAQQQDDCGGVSSP
AVSWSPSCISPAAVARSLGFRDPRCLQSMIICKQPEIGGPVPPHQDSSFLYTSPPSAVGFWYALQDASLANGCLS
FLPGSHRWAPIEQRLVRRGHGGAPP*
Coding >OphauG2|1021
ATGGCAAAGGGCCTCGACTCGGCACAAGTCGCCGCCTTTGAGCGCGATGGCTACCTCGTGATTCCTGGCGCACTA
AGCGCATCGAGCGTTGCCAACCTCTTGTCCGAGACGCAGCGCCTCCTCGGCGATTTCTCCCTCGACGAGCATCCG
CTCACACGCTTCACAACAGGCCAGGGCTCGACGGGGGAGCATATCGGCGACGAGTACTTTCTCTCCTCGGGGGAC
AAGGTGCGCTTCTTTTTCGAGGAGGATGCGTTTGACGAGCAGGGGAGGCTGGTGCGGGACAAGGAGCGCGCGGTG
AATAAGATTGGCCATGGCCTACACATGCAAAAGGGTCCGTTTGGGGCGTTGCTCCAAGGAGCAGGCGGCGAGGTG
GCCAGCGGACATGAAGATATACAGACGGCCCCCGTTGCGCAGCAACAAGATGATTGTGGTGGCGTGAGCTCTCCC
GCGGTGTCATGGTCGCCCTCGTGCATTTCTCCCGCCGCCGTGGCGCGCTCCCTCGGCTTCCGCGACCCGCGCTGT
CTGCAGAGCATGATTATATGCAAACAGCCCGAAATCGGCGGCCCCGTGCCCCCGCACCAAGACTCCTCCTTTCTC
TACACGAGCCCGCCCTCGGCCGTGGGCTTTTGGTACGCGCTGCAGGACGCGTCTCTTGCCAATGGCTGTCTCAGC
TTCTTGCCTGGCTCGCACCGCTGGGCGCCTATTGAGCAACGCCTTGTGCGCCGTGGACACGGCGGCGCACCGCCA
TGA
Transcript >OphauG2|1021
ATGGCAAAGGGCCTCGACTCGGCACAAGTCGCCGCCTTTGAGCGCGATGGCTACCTCGTGATTCCTGGCGCACTA
AGCGCATCGAGCGTTGCCAACCTCTTGTCCGAGACGCAGCGCCTCCTCGGCGATTTCTCCCTCGACGAGCATCCG
CTCACACGCTTCACAACAGGCCAGGGCTCGACGGGGGAGCATATCGGCGACGAGTACTTTCTCTCCTCGGGGGAC
AAGGTGCGCTTCTTTTTCGAGGAGGATGCGTTTGACGAGCAGGGGAGGCTGGTGCGGGACAAGGAGCGCGCGGTG
AATAAGATTGGCCATGGCCTACACATGCAAAAGGGTCCGTTTGGGGCGTTGCTCCAAGGAGCAGGCGGCGAGGTG
GCCAGCGGACATGAAGATATACAGACGGCCCCCGTTGCGCAGCAACAAGATGATTGTGGTGGCGTGAGCTCTCCC
GCGGTGTCATGGTCGCCCTCGTGCATTTCTCCCGCCGCCGTGGCGCGCTCCCTCGGCTTCCGCGACCCGCGCTGT
CTGCAGAGCATGATTATATGCAAACAGCCCGAAATCGGCGGCCCCGTGCCCCCGCACCAAGACTCCTCCTTTCTC
TACACGAGCCCGCCCTCGGCCGTGGGCTTTTGGTACGCGCTGCAGGACGCGTCTCTTGCCAATGGCTGTCTCAGC
TTCTTGCCTGGCTCGCACCGCTGGGCGCCTATTGAGCAACGCCTTGTGCGCCGTGGACACGGCGGCGCACCGCCA
TGA
Gene >OphauG2|1021
ATGGCAAAGGGCCTCGACTCGGCACAAGTCGCCGCCTTTGAGCGCGATGGCTACCTCGTGATTCCTGGCGCACTA
AGCGCATCGAGCGTTGCCAACCTCTTGTCCGAGACGCAGCGCCTCCTCGGCGATTTCTCCCTCGACGAGCATCCG
CTCACACGCTTCACAACAGGCCAGGGCTCGACGGGGGAGCATATCGGCGACGAGTACTTTCTCTCCTCGGGGGAC
AAGGTGCGCTTCTTTTTCGAGGAGGATGCGTTTGACGAGCAGGGGAGGCTGGTGCGGGACAAGGAGCGCGCGGTG
AATAAGATTGGCCATGGCCTACACATGCAAAAGGGTCCGTTTGGGGCGTTGCTCCAAGGAGCAGGCGGCGAGGTG
GCCAGCGGACATGAAGATATACAGACGGCCCCCGTTGCGCAGCAACAAGATGATTGTGGTGGCGTGAGCTCTCCC
GCGGTGTCATGGTCGCCCTCGTGCATTTCTCCCGCCGCCGTGGCGCGCTCCCTCGGCTTCCGCGACCCGCGCTGT
CTGCAGAGCATGATTATATGCAAACAGCCCGAAATCGGCGGCCCCGTGCCCCCGCACCAAGACTCCTCCTTTCTC
TACACGAGCCCGCCCTCGGCCGTGGGCTTTTGGTACGCGCTGCAGGACGCGTCTCTTGCCAATGGCTGTCTCAGC
TTCTTGCCTGGCTCGCACCGCTGGGCGCCTATTGAGCAACGCCTTGTGCGCCGTGGACACGGCGGCGGTACATGC
ATGGTGCAAAACGACGGCTTGGCCTTTCCTGCGGCCCATGACCATTGGCCCACGGCGGAGCAGCACCGCCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail