Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1019
Gene name
LocationContig_1278:3115..4511
Strand-
Gene length (bp)1396
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20511 PMI_typeI_cat Phosphomannose isomerase type I, catalytic domain 1.5E-54 7 153
PF01238 PMI_typeI_C Phosphomannose isomerase type I C-terminal 3.0E-14 353 398
PF20512 PMI_typeI_hel Phosphomannose isomerase type I, helical insertion domain 2.5E-09 180 263

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q66WM4|MPI_ASPFU Mannose-6-phosphate isomerase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmi1 PE=2 SV=2 5 442 0.0E+00
sp|Q870Y1|MPI_NEUCR Mannose-6-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=103E1.170 PE=3 SV=1 2 437 0.0E+00
sp|P29951|MPI_EMENI Mannose-6-phosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manA PE=3 SV=2 3 442 2.0E-175
sp|P29952|MPI_YEAST Mannose-6-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMI40 PE=1 SV=4 7 438 4.0E-124
sp|Q76IQ2|MPI_CANGA Mannose-6-phosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PMI1 PE=3 SV=1 7 438 1.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q66WM4|MPI_ASPFU Mannose-6-phosphate isomerase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=pmi1 PE=2 SV=2 5 442 0.0E+00
sp|Q870Y1|MPI_NEUCR Mannose-6-phosphate isomerase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=103E1.170 PE=3 SV=1 2 437 0.0E+00
sp|P29951|MPI_EMENI Mannose-6-phosphate isomerase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=manA PE=3 SV=2 3 442 2.0E-175
sp|P29952|MPI_YEAST Mannose-6-phosphate isomerase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMI40 PE=1 SV=4 7 438 4.0E-124
sp|Q76IQ2|MPI_CANGA Mannose-6-phosphate isomerase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PMI1 PE=3 SV=1 7 438 1.0E-122
sp|O43014|MPI_SCHPO Mannose-6-phosphate isomerase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmi40 PE=3 SV=1 7 439 1.0E-121
sp|P34948|MPI_CANAL Mannose-6-phosphate isomerase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PMI1 PE=1 SV=2 7 438 3.0E-121
sp|Q75AB5|MPI_ASHGO Mannose-6-phosphate isomerase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PMI1 PE=3 SV=1 3 438 1.0E-120
sp|Q8J093|MPI_OGAPD Mannose-6-phosphate isomerase OS=Ogataea parapolymorpha (strain DL-1 / ATCC 26012 / NRRL Y-7560) GN=PMI40 PE=3 SV=1 7 438 5.0E-119
sp|Q3SZI0|MPI_BOVIN Mannose-6-phosphate isomerase OS=Bos taurus GN=MPI PE=2 SV=3 10 437 4.0E-101
sp|Q8HXX2|MPI_MACFA Mannose-6-phosphate isomerase OS=Macaca fascicularis GN=MPI PE=2 SV=3 10 437 3.0E-100
sp|P34949|MPI_HUMAN Mannose-6-phosphate isomerase OS=Homo sapiens GN=MPI PE=1 SV=2 10 437 9.0E-100
sp|A5A6K3|MPI_PANTR Mannose-6-phosphate isomerase OS=Pan troglodytes GN=MPI PE=2 SV=1 10 437 3.0E-99
sp|Q68FX1|MPI_RAT Mannose-6-phosphate isomerase OS=Rattus norvegicus GN=Mpi PE=2 SV=1 10 437 5.0E-98
sp|Q9HFU4|MPI_CRYNJ Mannose-6-phosphate isomerase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MAN1 PE=3 SV=2 7 438 4.0E-94
sp|Q924M7|MPI_MOUSE Mannose-6-phosphate isomerase OS=Mus musculus GN=Mpi PE=1 SV=1 10 437 5.0E-94
sp|Q9FZH5|MPI2_ARATH Mannose-6-phosphate isomerase 2 OS=Arabidopsis thaliana GN=PMI2 PE=1 SV=1 9 412 6.0E-89
sp|Q9GP38|MPI_ECHMU Probable mannose-6-phosphate isomerase OS=Echinococcus multilocularis GN=PMIH PE=2 SV=1 7 436 3.0E-84
sp|Q9M884|MPI1_ARATH Mannose-6-phosphate isomerase 1 OS=Arabidopsis thaliana GN=PMI1 PE=1 SV=1 12 423 3.0E-81
sp|P34650|MPI_CAEEL Probable mannose-6-phosphate isomerase OS=Caenorhabditis elegans GN=ZK632.4 PE=3 SV=3 7 437 2.0E-71
sp|Q54PA0|MPI_DICDI Probable mannose-6-phosphate isomerase OS=Dictyostelium discoideum GN=mpi PE=3 SV=1 7 412 7.0E-70
sp|P00946|MANA_ECOLI Mannose-6-phosphate isomerase OS=Escherichia coli (strain K12) GN=manA PE=1 SV=1 9 414 2.0E-43
sp|Q83KZ1|MANA_SHIFL Mannose-6-phosphate isomerase OS=Shigella flexneri GN=manA PE=3 SV=4 9 414 2.0E-42
sp|P25081|MANA_SALTY Mannose-6-phosphate isomerase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=manA PE=1 SV=2 9 426 9.0E-41
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0004476 mannose-6-phosphate isomerase activity Yes
GO:0016861 intramolecular oxidoreductase activity, interconverting aldoses and ketoses No
GO:0003674 molecular_function No
GO:0016853 isomerase activity No
GO:0008150 biological_process No
GO:0043167 ion binding No
GO:0016860 intramolecular oxidoreductase activity No
GO:0008152 metabolic process No
GO:0005488 binding No
GO:0071704 organic substance metabolic process No
GO:0043169 cation binding No
GO:0046872 metal ion binding No
GO:0003824 catalytic activity No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 17 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1019
MVLQVPLLRLQCGVNSYQWGKRGFDSAAARFAAATPSANLEIDPNKPYAELWMGTHPSNPSLHVDTGRSLLQLCS
ENQMLLSQAVAAKYGGRLPFLFKVLSINKALSIQAHPNKTLAEQLHARDPSNYPDDNHKPEMAIAITAFEGLCGF
RPLAEVAHFLDALPPLRRLVGETNALAFIHAANQDTPDSNKPALKAAFAGLMSSSPQDVEREVAELVSLAKTQGH
DFAAGGVPSTRGAVLADLVTRLYAEFAADVGIFVLFFLNLVCLQPGEALFLVADDIHAYLSGDIIECMAASDNVV
RAGLTPKFKDVDTLVQMLTYNHAPIEAQKMVPTEYPYATLNRTAYGTGSAVTLYDPPIEEFSVLRTVLRGDMAKA
TFEPIDGPSIVLCTQGQGTIAIGPTRREMKEGFVYFVGSMAECVLESNGAGDDEFVTFRAFCEVGQERQKL*
Coding >OphauG2|1019
ATGGTCTTGCAAGTCCCGCTGCTGCGTCTCCAGTGTGGCGTCAATTCATACCAATGGGGCAAAAGGGGCTTCGAC
TCTGCTGCTGCCCGCTTTGCTGCTGCCACGCCCTCGGCCAACCTTGAAATCGACCCCAACAAGCCCTATGCCGAG
CTATGGATGGGCACCCATCCCTCGAACCCCTCGCTCCATGTCGACACTGGCCGCTCCCTGCTCCAGCTCTGCTCC
GAGAATCAGATGCTGCTCTCGCAAGCCGTCGCGGCAAAGTATGGCGGCCGCTTGCCCTTCCTCTTCAAGGTTCTC
TCCATCAACAAGGCCCTGTCCATCCAGGCACACCCCAACAAGACGCTAGCCGAGCAGCTCCACGCCCGCGACCCC
AGCAATTACCCCGACGACAACCACAAGCCTGAAATGGCAATCGCCATTACTGCCTTTGAGGGCCTGTGCGGCTTT
AGGCCCTTGGCAGAGGTGGCCCATTTCCTCGACGCCTTGCCGCCCTTGCGCCGCCTCGTCGGCGAGACCAACGCC
CTCGCCTTTATCCACGCCGCCAACCAAGACACCCCCGACAGCAACAAGCCCGCTCTCAAGGCCGCCTTTGCAGGC
CTCATGTCTAGCTCGCCCCAAGATGTTGAGCGCGAGGTGGCCGAGCTGGTCAGCCTGGCAAAGACACAGGGCCAC
GACTTTGCAGCCGGCGGCGTGCCATCGACACGAGGCGCCGTCTTGGCAGACCTTGTCACCAGGCTCTACGCCGAG
TTTGCCGCCGATGTCGGCATTTTCGTTCTCTTCTTCCTCAACCTGGTGTGCCTGCAGCCGGGCGAGGCCCTCTTC
CTGGTGGCCGACGACATTCACGCCTATCTCTCGGGCGACATTATCGAGTGCATGGCAGCCTCGGACAATGTGGTG
CGCGCCGGCCTGACGCCAAAGTTCAAGGACGTGGATACTCTGGTGCAGATGCTCACCTACAACCACGCTCCCATT
GAGGCGCAAAAGATGGTGCCCACCGAGTATCCCTATGCCACGCTCAATCGCACCGCATACGGCACAGGCTCGGCT
GTGACTCTGTATGATCCGCCCATTGAAGAGTTTTCCGTCTTGCGCACCGTGCTGCGGGGGGACATGGCCAAGGCC
ACCTTTGAACCCATTGACGGGCCCAGCATAGTCTTGTGCACCCAGGGCCAGGGCACCATTGCCATAGGCCCGACG
CGCCGGGAAATGAAGGAGGGCTTTGTCTACTTTGTCGGCTCCATGGCCGAGTGTGTGCTCGAGTCCAATGGCGCA
GGTGACGACGAGTTTGTTACGTTTCGAGCATTTTGTGAAGTGGGGCAGGAAAGGCAAAAGCTTTAA
Transcript >OphauG2|1019
ATGGTCTTGCAAGTCCCGCTGCTGCGTCTCCAGTGTGGCGTCAATTCATACCAATGGGGCAAAAGGGGCTTCGAC
TCTGCTGCTGCCCGCTTTGCTGCTGCCACGCCCTCGGCCAACCTTGAAATCGACCCCAACAAGCCCTATGCCGAG
CTATGGATGGGCACCCATCCCTCGAACCCCTCGCTCCATGTCGACACTGGCCGCTCCCTGCTCCAGCTCTGCTCC
GAGAATCAGATGCTGCTCTCGCAAGCCGTCGCGGCAAAGTATGGCGGCCGCTTGCCCTTCCTCTTCAAGGTTCTC
TCCATCAACAAGGCCCTGTCCATCCAGGCACACCCCAACAAGACGCTAGCCGAGCAGCTCCACGCCCGCGACCCC
AGCAATTACCCCGACGACAACCACAAGCCTGAAATGGCAATCGCCATTACTGCCTTTGAGGGCCTGTGCGGCTTT
AGGCCCTTGGCAGAGGTGGCCCATTTCCTCGACGCCTTGCCGCCCTTGCGCCGCCTCGTCGGCGAGACCAACGCC
CTCGCCTTTATCCACGCCGCCAACCAAGACACCCCCGACAGCAACAAGCCCGCTCTCAAGGCCGCCTTTGCAGGC
CTCATGTCTAGCTCGCCCCAAGATGTTGAGCGCGAGGTGGCCGAGCTGGTCAGCCTGGCAAAGACACAGGGCCAC
GACTTTGCAGCCGGCGGCGTGCCATCGACACGAGGCGCCGTCTTGGCAGACCTTGTCACCAGGCTCTACGCCGAG
TTTGCCGCCGATGTCGGCATTTTCGTTCTCTTCTTCCTCAACCTGGTGTGCCTGCAGCCGGGCGAGGCCCTCTTC
CTGGTGGCCGACGACATTCACGCCTATCTCTCGGGCGACATTATCGAGTGCATGGCAGCCTCGGACAATGTGGTG
CGCGCCGGCCTGACGCCAAAGTTCAAGGACGTGGATACTCTGGTGCAGATGCTCACCTACAACCACGCTCCCATT
GAGGCGCAAAAGATGGTGCCCACCGAGTATCCCTATGCCACGCTCAATCGCACCGCATACGGCACAGGCTCGGCT
GTGACTCTGTATGATCCGCCCATTGAAGAGTTTTCCGTCTTGCGCACCGTGCTGCGGGGGGACATGGCCAAGGCC
ACCTTTGAACCCATTGACGGGCCCAGCATAGTCTTGTGCACCCAGGGCCAGGGCACCATTGCCATAGGCCCGACG
CGCCGGGAAATGAAGGAGGGCTTTGTCTACTTTGTCGGCTCCATGGCCGAGTGTGTGCTCGAGTCCAATGGCGCA
GGTGACGACGAGTTTGTTACGTTTCGAGCATTTTGTGAAGTGGGGCAGGAAAGGCAAAAGCTTTAA
Gene >OphauG2|1019
ATGGTCTTGCAAGTCCCGCTGCTGCGTCTCCAGTGTGGCGTCAATTCATACCAATGGGGCAAAAGGGGCTTCGAC
TCTGCTGCTGCCCGCTTTGCTGCTGCCACGCCCTCGGCCAACCTTGAAATCGACCCCAACAAGCCCTATGCCGAG
GTCTGCAGTCACCAGCTCCGGCACAGGCAAACAGGGTGCTAATTCCCATGGGCAGCTATGGATGGGCACCCATCC
CTCGAACCCCTCGCTCCATGTCGACACTGGCCGCTCCCTGCTCCAGCTCTGCTCCGAGAATCAGATGCTGCTCTC
GCAAGCCGTCGCGGCAAAGTATGGCGGCCGCTTGCCCTTCCTCTTCAAGGTTCTCTCCATCAACAAGGCCCTGTC
CATCCAGGCACACCCCAACAAGACGCTAGCCGAGCAGCTCCACGCCCGCGACCCCAGCAATTACCCCGACGACAA
CCACAAGCCTGAAATGGCAATCGCCATTACTGCCTTTGAGGGCCTGTGCGGCTTTAGGCCCTTGGCAGAGGTGGC
CCATTTCCTCGACGCCTTGCCGCCCTTGCGCCGCCTCGTCGGCGAGACCAACGCCCTCGCCTTTATCCACGCCGC
CAACCAAGACACCCCCGACAGCAACAAGCCCGCTCTCAAGGCCGCCTTTGCAGGCCTCATGTCTAGCTCGCCCCA
AGATGTTGAGCGCGAGGTGGCCGAGCTGGTCAGCCTGGCAAAGACACAGGGCCACGACTTTGCAGCCGGCGGCGT
GCCATCGACACGAGGCGCCGTCTTGGCAGACCTTGTCACCAGGCTCTACGCCGAGTTTGCCGCCGATGTCGGCAT
TTTCGTTCTCTTCTTCCTCAACCTGGTGTGCCTGCAGCCGGGCGAGGCCCTCTTCCTGGTGGCCGACGACATTCA
CGCCTATCTCTCGGGCGACATTATCGAGTGCATGGCAGCCTCGGACAATGTGGTGCGCGCCGGCCTGACGCCAAA
GTTCAAGGACGTGGATACTCTGGTGCAGATGCTCACCTACAACCACGCTCCCATTGAGGCGCAAAAGATGGTGCC
CACCGAGTATCCCTATGCCACGCTCAATCGCACCGCATACGGCACAGGCTCGGCTGTGACTCTGTATGATCCGCC
CATTGAAGAGTTTTCCGTCTTGCGCACCGTGCTGCGGGGGGACATGGCCAAGGCCACCTTTGAACCCATTGACGG
GCCCAGCATAGTCTTGTGCACCCAGGGCCAGGGCACCATTGCCATAGGCCCGACGCGCCGGGAAATGAAGGAGGG
CTTTGTCTACTTTGTCGGCTCCATGGCCGAGTGTGTGCTCGAGTCCAATGGCGCAGGTGACGACGAGTTTGTTAC
GTTTCGAGCATTTTGTGAAGTGGGGCAGGAAAGGCAAAAGCTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail