Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1018
Gene name
LocationContig_1278:137..2470
Strand+
Gene length (bp)2333
Transcript length (bp)2148
Coding sequence length (bp)2148
Protein length (aa) 716

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13692 Glyco_trans_1_4 Glycosyl transferases group 1 1.6E-17 362 509
PF00534 Glycos_transf_1 Glycosyl transferases group 1 6.5E-17 357 508
PF11997 DUF3492 Domain of unknown function (DUF3492) 2.7E-06 33 324

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0016757 glycosyltransferase activity Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016740 transferase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 54 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1018
MGLGKDATQVTSRPSDCFRDTPDRISVIFNDIGCWPEAPGGVSNCRRDLVDGHSTIRNHVLAECANDFGIPRFQI
ERNVQSLKLLPLWGLDGKTAYHGLLDNLLQSQVDDKIAQTHLQRDIVAVFIPLLRDFVKGARTKSYSRADLIKYT
NVMLSMNKYYEHKDYNQTWASKPVQDAWADAWLLPYHDDNISDPAHHFAIERPSMMDFRDALGIYLAYFFIFSVS
IPDDCPRVFQSTHHGISSLFGMILKYRRGTTFGIWDHAILWRESCLNISPAQCELSIPVQSMLLAGMRLASRLAY
FHADIVVPCTSLFNPMWETEIGTDQGTLCNKNLFARKIDPIVNGISNMDSFKPVDKVRTDTPTVVMLSNVQFIKG
IKTAILAADLIVNRYGFSDYRLMIYGAKDRQPSYALEMAKLIVKCNLSENVVLAGFGKPKEVLQDAWLFVNSSIS
EGLPLAIGEAALAGVPIVATEVGATALVVTDPDDPDKRYGEVVAPNDAVALARAQLSLLCMIGPWAKFTADGAKD
DAAAPLPEDIGPDDTRRLLQRMYDKSPDRRRLGLLSREVVLHSFHGRRYLREHEQMFWIQWHMAKMRANAASGAA
ASPSTAKFGAMAPLRYSEAHVELLDDQDEDEWLAHDDQARHDDSDTALDSEAERFKLVETPDTAHHHHSDSVDSE
AQTVRPPASNVKARLSKMLMRPSLAKNLHASLNTMEATVH*
Coding >OphauG2|1018
ATGGGCCTGGGCAAAGACGCCACCCAGGTCACCAGCCGCCCGTCCGACTGCTTCCGCGACACCCCCGACCGCATC
TCCGTCATCTTCAACGACATTGGCTGCTGGCCCGAGGCCCCCGGCGGCGTCTCCAACTGCCGCCGCGACCTGGTC
GACGGCCACAGCACCATCCGCAACCACGTCCTGGCCGAGTGCGCCAACGACTTTGGCATCCCGCGCTTCCAGATT
GAGCGCAACGTCCAGTCGCTCAAGCTGCTGCCGCTGTGGGGGCTCGACGGCAAAACCGCCTACCACGGCCTGCTC
GACAACCTGCTGCAGTCGCAGGTGGACGACAAGATTGCCCAAACCCACCTCCAGCGCGACATTGTCGCCGTCTTC
ATCCCCCTGCTGCGCGACTTTGTCAAGGGCGCCCGCACCAAGTCGTACTCGCGCGCCGACCTCATCAAGTACACC
AATGTCATGCTGTCCATGAACAAGTACTACGAGCACAAGGACTACAACCAGACCTGGGCCTCCAAGCCCGTCCAG
GACGCCTGGGCCGATGCCTGGCTGCTGCCCTACCACGACGACAACATCTCGGACCCCGCCCACCACTTTGCCATT
GAGCGGCCCAGCATGATGGACTTTCGCGACGCCCTCGGCATCTACCTGGCCTACTTTTTCATCTTTTCCGTCAGC
ATCCCCGACGACTGCCCCCGCGTCTTCCAGAGCACCCACCACGGCATCAGCAGTCTGTTTGGCATGATTCTCAAG
TACCGCCGCGGCACCACCTTTGGCATCTGGGACCACGCCATTTTGTGGCGCGAGAGCTGCCTCAACATTAGCCCG
GCCCAGTGCGAGCTGTCCATTCCCGTCCAGTCCATGCTGCTGGCCGGCATGCGCCTGGCGAGCCGCCTGGCCTAT
TTCCACGCCGACATTGTGGTGCCCTGCACCTCGCTCTTTAACCCCATGTGGGAAACCGAAATCGGCACCGACCAG
GGCACCCTCTGCAACAAGAACCTCTTTGCCCGCAAAATCGACCCCATTGTCAACGGCATCAGCAACATGGACTCC
TTCAAGCCCGTCGACAAGGTCCGCACCGACACCCCCACCGTCGTCATGCTCTCCAACGTGCAGTTCATCAAGGGC
ATCAAAACCGCCATCCTGGCCGCCGACCTCATTGTCAACCGCTACGGCTTCTCCGACTACCGCCTCATGATCTAC
GGCGCCAAGGACCGCCAGCCCTCGTACGCCCTGGAAATGGCCAAGCTCATTGTCAAGTGCAACCTGTCGGAAAAC
GTCGTCCTGGCCGGCTTCGGCAAGCCCAAGGAGGTGCTGCAGGATGCCTGGCTCTTTGTCAACTCGTCCATCTCC
GAAGGCCTGCCCCTGGCCATTGGCGAGGCCGCCCTGGCCGGCGTGCCCATTGTCGCCACCGAGGTGGGCGCCACC
GCCCTCGTCGTCACCGATCCCGACGACCCCGACAAGCGCTACGGCGAGGTGGTGGCTCCCAACGACGCCGTCGCC
CTGGCCCGCGCCCAGCTCAGCCTGCTCTGCATGATTGGGCCCTGGGCCAAGTTTACCGCCGACGGCGCCAAGGAC
GATGCCGCCGCGCCCCTGCCCGAGGACATTGGGCCCGACGACACGCGCCGCCTGCTGCAGCGCATGTACGACAAG
AGCCCCGACCGCCGCCGCCTCGGCCTCTTGTCGCGCGAGGTGGTGCTGCACAGCTTCCACGGCCGCCGCTACCTG
CGCGAGCACGAGCAAATGTTTTGGATCCAGTGGCACATGGCCAAGATGCGCGCCAACGCTGCCTCGGGCGCCGCC
GCCTCGCCATCCACCGCCAAGTTTGGCGCCATGGCCCCCTTGCGCTACTCCGAGGCCCATGTTGAGCTGCTCGAC
GACCAAGACGAAGACGAGTGGCTGGCCCACGACGACCAAGCCCGCCACGACGACAGCGACACCGCCCTCGACTCT
GAGGCGGAGCGCTTCAAGCTCGTCGAGACGCCCGACACGGCCCATCACCACCACTCGGACAGCGTCGACTCCGAG
GCCCAGACGGTTCGCCCGCCCGCGAGCAACGTCAAGGCCCGCCTCTCCAAGATGCTGATGCGGCCCAGCCTTGCC
AAGAATCTGCATGCCAGCCTCAATACCATGGAGGCCACCGTCCATTGA
Transcript >OphauG2|1018
ATGGGCCTGGGCAAAGACGCCACCCAGGTCACCAGCCGCCCGTCCGACTGCTTCCGCGACACCCCCGACCGCATC
TCCGTCATCTTCAACGACATTGGCTGCTGGCCCGAGGCCCCCGGCGGCGTCTCCAACTGCCGCCGCGACCTGGTC
GACGGCCACAGCACCATCCGCAACCACGTCCTGGCCGAGTGCGCCAACGACTTTGGCATCCCGCGCTTCCAGATT
GAGCGCAACGTCCAGTCGCTCAAGCTGCTGCCGCTGTGGGGGCTCGACGGCAAAACCGCCTACCACGGCCTGCTC
GACAACCTGCTGCAGTCGCAGGTGGACGACAAGATTGCCCAAACCCACCTCCAGCGCGACATTGTCGCCGTCTTC
ATCCCCCTGCTGCGCGACTTTGTCAAGGGCGCCCGCACCAAGTCGTACTCGCGCGCCGACCTCATCAAGTACACC
AATGTCATGCTGTCCATGAACAAGTACTACGAGCACAAGGACTACAACCAGACCTGGGCCTCCAAGCCCGTCCAG
GACGCCTGGGCCGATGCCTGGCTGCTGCCCTACCACGACGACAACATCTCGGACCCCGCCCACCACTTTGCCATT
GAGCGGCCCAGCATGATGGACTTTCGCGACGCCCTCGGCATCTACCTGGCCTACTTTTTCATCTTTTCCGTCAGC
ATCCCCGACGACTGCCCCCGCGTCTTCCAGAGCACCCACCACGGCATCAGCAGTCTGTTTGGCATGATTCTCAAG
TACCGCCGCGGCACCACCTTTGGCATCTGGGACCACGCCATTTTGTGGCGCGAGAGCTGCCTCAACATTAGCCCG
GCCCAGTGCGAGCTGTCCATTCCCGTCCAGTCCATGCTGCTGGCCGGCATGCGCCTGGCGAGCCGCCTGGCCTAT
TTCCACGCCGACATTGTGGTGCCCTGCACCTCGCTCTTTAACCCCATGTGGGAAACCGAAATCGGCACCGACCAG
GGCACCCTCTGCAACAAGAACCTCTTTGCCCGCAAAATCGACCCCATTGTCAACGGCATCAGCAACATGGACTCC
TTCAAGCCCGTCGACAAGGTCCGCACCGACACCCCCACCGTCGTCATGCTCTCCAACGTGCAGTTCATCAAGGGC
ATCAAAACCGCCATCCTGGCCGCCGACCTCATTGTCAACCGCTACGGCTTCTCCGACTACCGCCTCATGATCTAC
GGCGCCAAGGACCGCCAGCCCTCGTACGCCCTGGAAATGGCCAAGCTCATTGTCAAGTGCAACCTGTCGGAAAAC
GTCGTCCTGGCCGGCTTCGGCAAGCCCAAGGAGGTGCTGCAGGATGCCTGGCTCTTTGTCAACTCGTCCATCTCC
GAAGGCCTGCCCCTGGCCATTGGCGAGGCCGCCCTGGCCGGCGTGCCCATTGTCGCCACCGAGGTGGGCGCCACC
GCCCTCGTCGTCACCGATCCCGACGACCCCGACAAGCGCTACGGCGAGGTGGTGGCTCCCAACGACGCCGTCGCC
CTGGCCCGCGCCCAGCTCAGCCTGCTCTGCATGATTGGGCCCTGGGCCAAGTTTACCGCCGACGGCGCCAAGGAC
GATGCCGCCGCGCCCCTGCCCGAGGACATTGGGCCCGACGACACGCGCCGCCTGCTGCAGCGCATGTACGACAAG
AGCCCCGACCGCCGCCGCCTCGGCCTCTTGTCGCGCGAGGTGGTGCTGCACAGCTTCCACGGCCGCCGCTACCTG
CGCGAGCACGAGCAAATGTTTTGGATCCAGTGGCACATGGCCAAGATGCGCGCCAACGCTGCCTCGGGCGCCGCC
GCCTCGCCATCCACCGCCAAGTTTGGCGCCATGGCCCCCTTGCGCTACTCCGAGGCCCATGTTGAGCTGCTCGAC
GACCAAGACGAAGACGAGTGGCTGGCCCACGACGACCAAGCCCGCCACGACGACAGCGACACCGCCCTCGACTCT
GAGGCGGAGCGCTTCAAGCTCGTCGAGACGCCCGACACGGCCCATCACCACCACTCGGACAGCGTCGACTCCGAG
GCCCAGACGGTTCGCCCGCCCGCGAGCAACGTCAAGGCCCGCCTCTCCAAGATGCTGATGCGGCCCAGCCTTGCC
AAGAATCTGCATGCCAGCCTCAATACCATGGAGGCCACCGTCCATTGA
Gene >OphauG2|1018
ATGGGCCTGGGCAAAGACGCCACCCAGGTCACCAGCCGCCCGTCCGACTGCTTCCGCGACACCCCCGACCGCATC
TCCGTCATCTTCAACGACATTGGCTGCTGGCCCGAGGCCCCCGGCGGCGTCTCCAACTGCCGCCGCGACCTGGTC
GACGGCCACAGCACCATCCGCAACCACGTCCTGGCCGAGTGCGCCAACGACTTTGGCATCCCGCGCTTCCAGATT
GAGCGCAACGTCCAGTCGCTCAAGCTGCTGCCGCTGTGGGGGCTCGACGGCAAAACCGCCTACCACGGCCTGCTC
GACAACCTGCTGCAGTCGCAGGTGGACGACAAGATTGCCCAAACCCACCTCCAGCGCGACATTGTCGCCGTCTTC
ATCCCCCTGCTGCGCGACTTTGTCAAGGGCGCCCGCACCAAGTCGTACTCGCGCGCCGACCTCATCAAGTACACC
AATGTCATGCTGTCCATGAACAAGTACTACGAGCACAAGGACTACAACCAGACCTGGGCCTCCAAGCCCGTCCAG
GACGCCTGGGCCGATGCCTGGCTGCTGCCCTACCACGACGACAACATCTCGGACCCCGCCCACCACTTTGCCATT
GAGCGGCCCAGCATGATGGACTTTCGCGACGCCCTCGGCATCTACCTGGCCTACTTTTTCATCTTTTCCGTCAGC
ATCCCCGACGACTGCCCCCGCGTCTTCCAGAGCACCCACCACGGCATCAGCAGTCTGTTTGGCATGATTCTCAAG
TACCGCCGCGGCACCACCTTTGGCATCTGGGACCACGCCATTTTGTGGCGCGAGAGCTGCCTCAACATTAGCCCG
GCCCAGTGCGAGCTGTCCATTCCCGTCCAGTCCATGCTGCTGGCCGGCATGCGCCTGGCGAGCCGCCTGGCCTAT
TTCCACGCCGACATTGTGGTGCCCTGCACCTCGCTCTTTAACCCGCAAGTCTCTCCCCTCTCCTCTGCCCTGCCC
TCTCCTCTGCCCTCTCCTCTCCTCTGCCCTCCCCTAACCTCTCCTCTGCCCTCCCCTAACCTCTCCTCTGCCCTC
CCCTACCCTCCGTCACCCTCATCCTCCTATCCTTTATTTTTTTTTTTTCCCTTCTTCCTTTTGCTAACCTCCCTC
GCAGCATGTGGGAAACCGAAATCGGCACCGACCAGGGCACCCTCTGCAACAAGAACCTCTTTGCCCGCAAAATCG
ACCCCATTGTCAACGGCATCAGCAACATGGACTCCTTCAAGCCCGTCGACAAGGTCCGCACCGACACCCCCACCG
TCGTCATGCTCTCCAACGTGCAGTTCATCAAGGGCATCAAAACCGCCATCCTGGCCGCCGACCTCATTGTCAACC
GCTACGGCTTCTCCGACTACCGCCTCATGATCTACGGCGCCAAGGACCGCCAGCCCTCGTACGCCCTGGAAATGG
CCAAGCTCATTGTCAAGTGCAACCTGTCGGAAAACGTCGTCCTGGCCGGCTTCGGCAAGCCCAAGGAGGTGCTGC
AGGATGCCTGGCTCTTTGTCAACTCGTCCATCTCCGAAGGCCTGCCCCTGGCCATTGGCGAGGCCGCCCTGGCCG
GCGTGCCCATTGTCGCCACCGAGGTGGGCGCCACCGCCCTCGTCGTCACCGATCCCGACGACCCCGACAAGCGCT
ACGGCGAGGTGGTGGCTCCCAACGACGCCGTCGCCCTGGCCCGCGCCCAGCTCAGCCTGCTCTGCATGATTGGGC
CCTGGGCCAAGTTTACCGCCGACGGCGCCAAGGACGATGCCGCCGCGCCCCTGCCCGAGGACATTGGGCCCGACG
ACACGCGCCGCCTGCTGCAGCGCATGTACGACAAGAGCCCCGACCGCCGCCGCCTCGGCCTCTTGTCGCGCGAGG
TGGTGCTGCACAGCTTCCACGGCCGCCGCTACCTGCGCGAGCACGAGCAAATGTTTTGGATCCAGTGGCACATGG
CCAAGATGCGCGCCAACGCTGCCTCGGGCGCCGCCGCCTCGCCATCCACCGCCAAGTTTGGCGCCATGGCCCCCT
TGCGCTACTCCGAGGCCCATGTTGAGCTGCTCGACGACCAAGACGAAGACGAGTGGCTGGCCCACGACGACCAAG
CCCGCCACGACGACAGCGACACCGCCCTCGACTCTGAGGCGGAGCGCTTCAAGCTCGTCGAGACGCCCGACACGG
CCCATCACCACCACTCGGACAGCGTCGACTCCGAGGCCCAGACGGTTCGCCCGCCCGCGAGCAACGTCAAGGCCC
GCCTCTCCAAGATGCTGATGCGGCCCAGCCTTGCCAAGAATCTGCATGCCAGCCTCAATACCATGGAGGCCACCG
TCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail