Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1014
Gene name
LocationContig_1276:1138..3205
Strand-
Gene length (bp)2067
Transcript length (bp)2067
Coding sequence length (bp)2067
Protein length (aa) 689

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13516 LRR_6 Leucine Rich repeat 1.3E-01 314 336
PF13516 LRR_6 Leucine Rich repeat 1.7E-03 409 431
PF13516 LRR_6 Leucine Rich repeat 2.4E-02 491 510
PF12937 F-box-like F-box-like 1.5E-10 171 215
PF00646 F-box F-box domain 4.2E-06 171 211
PF00560 LRR_1 Leucine Rich Repeat 1.2E+00 410 422

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 174 601 7.0E-42
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 174 601 1.0E-41
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 174 576 2.0E-41
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 174 576 4.0E-41
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 174 576 2.0E-40
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8BH16|FBXL2_MOUSE F-box/LRR-repeat protein 2 OS=Mus musculus GN=Fbxl2 PE=1 SV=1 174 601 7.0E-42
sp|Q9UKC9|FBXL2_HUMAN F-box/LRR-repeat protein 2 OS=Homo sapiens GN=FBXL2 PE=1 SV=3 174 601 1.0E-41
sp|Q5R3Z8|FBXL2_PONAB F-box/LRR-repeat protein 2 OS=Pongo abelii GN=FBXL2 PE=2 SV=1 174 576 2.0E-41
sp|A6H779|FBXL2_BOVIN F-box/LRR-repeat protein 2 OS=Bos taurus GN=FBXL2 PE=2 SV=1 174 576 4.0E-41
sp|Q9CZV8|FXL20_MOUSE F-box/LRR-repeat protein 20 OS=Mus musculus GN=Fbxl20 PE=1 SV=3 174 576 2.0E-40
sp|Q96IG2|FXL20_HUMAN F-box/LRR-repeat protein 20 OS=Homo sapiens GN=FBXL20 PE=1 SV=2 174 576 3.0E-40
sp|Q58DG6|FXL20_BOVIN F-box/LRR-repeat protein 20 OS=Bos taurus GN=FBXL20 PE=2 SV=2 174 576 3.0E-40
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 174 463 4.0E-31
sp|P34284|YKK7_CAEEL Uncharacterized F-box/LRR-repeat protein C02F5.7 OS=Caenorhabditis elegans GN=C02F5.7 PE=3 SV=3 174 601 3.0E-29
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 172 556 2.0E-21
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 172 556 2.0E-21
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 172 556 9.0E-20
sp|Q9Z0Z3|SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus GN=Skp2 PE=1 SV=1 171 465 2.0E-19
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 162 574 5.0E-19
sp|Q13309|SKP2_HUMAN S-phase kinase-associated protein 2 OS=Homo sapiens GN=SKP2 PE=1 SV=2 171 465 5.0E-18
sp|Q8N1E6|FXL14_HUMAN F-box/LRR-repeat protein 14 OS=Homo sapiens GN=FBXL14 PE=1 SV=1 177 576 5.0E-18
sp|Q8BID8|FXL14_MOUSE F-box/LRR-repeat protein 14 OS=Mus musculus GN=Fbxl14 PE=2 SV=1 177 576 1.0E-17
sp|Q17R01|FXL14_BOVIN F-box/LRR-repeat protein 14 OS=Bos taurus GN=FBXL14 PE=2 SV=1 177 576 1.0E-17
sp|C8V4D4|GRRA_EMENI SCF E3 ubiquitin ligase complex F-box protein grrA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=grrA PE=2 SV=1 174 539 6.0E-17
sp|A1A5X2|FBXL7_DANRE F-box/LRR-repeat protein 7 OS=Danio rerio GN=fbxl7 PE=2 SV=1 286 576 2.0E-16
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 239 468 5.0E-16
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 239 515 1.0E-15
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 239 576 2.0E-14
sp|Q5BJ29|FBXL7_MOUSE F-box/LRR-repeat protein 7 OS=Mus musculus GN=Fbxl7 PE=1 SV=1 299 576 4.0E-14
sp|Q9UJT9|FBXL7_HUMAN F-box/LRR-repeat protein 7 OS=Homo sapiens GN=FBXL7 PE=2 SV=1 299 576 5.0E-14
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 294 533 4.0E-13
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 174 589 6.0E-13
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 262 457 3.0E-12
sp|B5X441|FXL15_SALSA F-box/LRR-repeat protein 15 OS=Salmo salar GN=fbxl15 PE=2 SV=1 173 427 4.0E-12
sp|Q6NW95|FXL15_DANRE F-box/LRR-repeat protein 15 OS=Danio rerio GN=fbxl15 PE=2 SV=2 163 453 7.0E-12
sp|Q0VD31|FBXL4_BOVIN F-box/LRR-repeat protein 4 OS=Bos taurus GN=FBXL4 PE=2 SV=1 170 448 5.0E-11
sp|O74783|POF2_SCHPO SCF E3 ubiquitin ligase complex F-box protein pof2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof2 PE=1 SV=1 174 519 1.0E-10
sp|Q9UKA2|FBXL4_HUMAN F-box/LRR-repeat protein 4 OS=Homo sapiens GN=FBXL4 PE=1 SV=2 170 448 2.0E-10
sp|Q8NEE6|FXL13_HUMAN F-box/LRR-repeat protein 13 OS=Homo sapiens GN=FBXL13 PE=2 SV=3 295 504 7.0E-10
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 156 604 9.0E-10
sp|Q8LB33|FB330_ARATH F-box protein At3g58530 OS=Arabidopsis thaliana GN=At3g58530 PE=2 SV=1 277 503 1.0E-09
sp|E6ZHJ8|FXL15_DICLA F-box/LRR-repeat protein 15 OS=Dicentrarchus labrax GN=fbxl15 PE=3 SV=1 174 487 1.0E-09
sp|Q9QZH7|FXL20_RAT F-box/LRR-repeat protein 20 OS=Rattus norvegicus GN=Fbxl20 PE=1 SV=1 370 521 2.0E-09
sp|Q9C5D2|FBL4_ARATH F-box/LRR-repeat protein 4 OS=Arabidopsis thaliana GN=FBL4 PE=2 SV=1 204 540 2.0E-09
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 271 513 2.0E-09
sp|Q8BH70|FBXL4_MOUSE F-box/LRR-repeat protein 4 OS=Mus musculus GN=Fbxl4 PE=1 SV=1 170 509 2.0E-09
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 409 523 1.0E-08
sp|Q7SZ73|FXL15_XENLA F-box/LRR-repeat protein 15 OS=Xenopus laevis GN=fbxl15 PE=2 SV=1 174 389 4.0E-08
sp|Q8CDU4|FXL13_MOUSE F-box/LRR-repeat protein 13 OS=Mus musculus GN=Fbxl13 PE=2 SV=2 292 503 4.0E-08
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 285 453 4.0E-08
sp|Q9UF56|FXL17_HUMAN F-box/LRR-repeat protein 17 OS=Homo sapiens GN=FBXL17 PE=2 SV=3 172 534 5.0E-08
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 248 453 6.0E-08
sp|P24814|GRR1_YEAST SCF E3 ubiquitin ligase complex F-box protein GRR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GRR1 PE=1 SV=1 216 468 8.0E-08
sp|Q9LPL4|SKP2A_ARATH F-box protein SKP2A OS=Arabidopsis thaliana GN=SKP2A PE=1 SV=1 171 463 8.0E-08
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 311 514 2.0E-07
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 248 450 2.0E-07
sp|Q9QZN1|FXL17_MOUSE F-box/LRR-repeat protein 17 OS=Mus musculus GN=Fbxl17 PE=2 SV=3 172 523 2.0E-07
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 276 450 3.0E-07
sp|Q708Y0|EBF2_ARATH EIN3-binding F-box protein 2 OS=Arabidopsis thaliana GN=EBF2 PE=1 SV=1 302 530 3.0E-07
sp|O49286|SKP2B_ARATH F-box protein SKP2B OS=Arabidopsis thaliana GN=SKP2B PE=1 SV=1 409 578 4.0E-07
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 325 610 5.0E-07
sp|Q5R8X9|AMN1_PONAB Protein AMN1 homolog OS=Pongo abelii GN=AMN1 PE=2 SV=1 411 515 5.0E-07
sp|Q5XGC0|FXL15_XENTR F-box/LRR-repeat protein 15 OS=Xenopus tropicalis GN=fbxl15 PE=2 SV=1 174 389 5.0E-07
sp|Q8IY45|AMN1_HUMAN Protein AMN1 homolog OS=Homo sapiens GN=AMN1 PE=2 SV=4 411 515 6.0E-07
sp|Q6C725|AMN1_YARLI Antagonist of mitotic exit network protein 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=AMN1 PE=3 SV=1 286 450 9.0E-07
sp|E1BNS0|FXL15_BOVIN F-box/LRR-repeat protein 15 OS=Bos taurus GN=FBXL15 PE=3 SV=1 285 453 1.0E-06
sp|Q8N461|FXL16_HUMAN F-box/LRR-repeat protein 16 OS=Homo sapiens GN=FBXL16 PE=2 SV=2 182 508 1.0E-06
sp|A2RT62|FXL16_MOUSE F-box/LRR-repeat protein 16 OS=Mus musculus GN=Fbxl16 PE=1 SV=1 182 508 1.0E-06
sp|Q5MJ12|FXL16_RAT F-box/LRR-repeat protein 16 OS=Rattus norvegicus GN=Fbxl16 PE=2 SV=1 182 508 1.0E-06
sp|D4ABB4|FXL15_RAT F-box/LRR-repeat protein 15 OS=Rattus norvegicus GN=Fbxl15 PE=3 SV=1 316 450 1.0E-06
sp|Q91W61|FXL15_MOUSE F-box/LRR-repeat protein 15 OS=Mus musculus GN=Fbxl15 PE=1 SV=2 331 610 2.0E-06
sp|Q9SMY8|FBL15_ARATH F-box/LRR-repeat protein 15 OS=Arabidopsis thaliana GN=FBL15 PE=2 SV=2 315 508 2.0E-06
sp|Q640I9|KDM2B_XENLA Lysine-specific demethylase 2B OS=Xenopus laevis GN=kdm2b PE=2 SV=1 174 334 4.0E-06
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 291 530 4.0E-06
sp|Q5U201|AMN1_RAT Protein AMN1 homolog OS=Rattus norvegicus GN=Amn1 PE=2 SV=2 411 515 4.0E-06
sp|Q9Z0Z3|SKP2_MOUSE S-phase kinase-associated protein 2 OS=Mus musculus GN=Skp2 PE=1 SV=1 329 509 5.0E-06
sp|Q9H469|FXL15_HUMAN F-box/LRR-repeat protein 15 OS=Homo sapiens GN=FBXL15 PE=1 SV=2 359 610 5.0E-06
sp|E2RKN7|FXL15_CANLF F-box/LRR-repeat protein 15 OS=Canis lupus familiaris GN=FBXL15 PE=3 SV=1 359 610 7.0E-06
sp|Q9SKK0|EBF1_ARATH EIN3-binding F-box protein 1 OS=Arabidopsis thaliana GN=EBF1 PE=1 SV=1 271 477 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4618
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1014 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|7928
Ophiocordyceps camponoti-floridani Ophcf2|06493
Ophiocordyceps camponoti-rufipedis Ophun1|4966
Ophiocordyceps kimflemingae Ophio5|2969
Ophiocordyceps subramaniannii Hirsu2|9696

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1014
MAAGAPSSTRLHLDPSTPELPNKLKGRHRLLRELQRISSSPSLNSLRRSKSVGNPYSTRGTLSCVSLAAPGPSQM
PPAPRYPSPLASQTSSHSIPTAPMSLRTPTAAGDSPLCSNPSQDYLAARKIGNTISSSSPAISTLPMDLRCSRLE
RQQSRNRSNCQALQRRRFSFWDSMPYEMSIQIFSHLKPKELVRASRVSKLFHQFCFDGQLWTTLDASGFYREIPA
ESLTRIILAAGPFLKNLNLRGCVQIEHYKRTEAIISACSNLINATLEGCHNFPKGAVHSLLKSNGNLVHLNLTGL
SAVTNSSCRLIAQSCPRLESLNVSWCEKIRARGIKAVIESCPRLKDLRAGEVRGFDDVAVARCIFQSNNLEKLVL
CGCLELSDDALRIMMHGDDPEIDILTYKPLVPPRKLRHLDLSRCHRLSSEGVKAIAHVTPYLQGLQLSGCKSLTD
AAVEPILASTPRLTLLDLEEMAQLTNSLLANHLAKSPCTSKLEHLSLSYCENIGDDGMLPVMQNCIGLKSVDLDN
TRISDRVLLEATTLVLERSSLSTNANTKPKFTLQLAVYDCQHVTWKGIREILFRNAQVWSKLDVHGPTVYPTEAI
ALKCFYGFQMTVDEHQKRVLQGDFGSANRLERKWSEYMRAKEDAEADVTAYGRWRRRAREAQAAHLEEEDGSMGG
RRRARTLEACLVM*
Coding >OphauG2|1014
ATGGCTGCTGGTGCGCCGTCAAGCACCCGCCTCCACCTTGATCCATCGACGCCTGAGCTGCCCAACAAGCTAAAA
GGCCGTCACCGCCTGCTTCGGGAACTGCAGCGCATTTCTTCTTCGCCATCGCTCAATAGTCTTCGACGCTCGAAA
TCGGTTGGCAATCCCTACAGCACTCGAGGCACCCTTTCCTGTGTCAGCTTGGCCGCCCCGGGTCCCTCCCAGATG
CCACCTGCTCCTCGATACCCTTCACCATTGGCCTCGCAGACATCTTCTCATTCGATACCCACTGCTCCCATGTCG
CTGCGCACTCCGACCGCAGCCGGCGACTCGCCATTGTGCAGCAACCCCTCCCAAGACTATCTGGCTGCTCGAAAG
ATTGGAAACACCATCTCGTCTTCCTCTCCTGCCATTTCCACCTTGCCCATGGACCTCCGGTGCTCGAGGCTTGAA
AGACAACAGAGCCGCAACCGCTCAAATTGCCAAGCCCTGCAAAGACGACGCTTCTCTTTCTGGGACAGTATGCCC
TATGAAATGTCGATTCAAATCTTTTCCCATTTGAAACCAAAGGAGCTGGTCCGGGCATCGAGAGTGAGCAAGCTG
TTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACAACGCTGGATGCATCCGGCTTTTATCGAGAAATCCCCGCC
GAGTCTCTCACCAGAATCATCCTGGCTGCTGGTCCCTTTCTTAAAAACTTGAATCTTCGAGGCTGTGTGCAGATT
GAACACTACAAACGTACAGAAGCCATCATCAGTGCCTGCAGTAATCTCATCAACGCCACACTAGAGGGCTGCCAC
AACTTTCCAAAGGGCGCGGTCCACAGTCTATTGAAGAGCAATGGGAATCTGGTTCACCTCAACCTCACCGGGCTC
TCTGCTGTTACAAACTCGTCTTGTCGACTAATTGCCCAGTCGTGCCCTCGCCTGGAGTCGCTCAATGTGTCGTGG
TGCGAAAAGATTAGGGCGCGTGGCATCAAGGCCGTCATCGAATCGTGCCCCAGGCTGAAGGACCTGAGAGCCGGT
GAAGTCCGCGGATTCGATGATGTTGCCGTTGCCAGATGCATCTTCCAGTCAAACAACCTGGAAAAGCTAGTCCTG
TGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATTATGATGCACGGCGATGACCCAGAGATCGATATTCTG
ACATACAAGCCCCTCGTACCCCCTCGAAAACTGCGTCATCTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAA
GGAGTCAAAGCCATTGCCCACGTCACCCCCTATCTACAAGGGCTACAGCTTTCCGGATGCAAGTCCTTGACAGAC
GCAGCAGTCGAGCCTATTCTAGCTTCGACGCCCAGGCTCACATTGCTGGATCTCGAGGAGATGGCCCAATTGACC
AACTCATTACTTGCCAATCACTTGGCCAAATCTCCTTGTACCTCCAAGCTAGAGCATCTATCTCTGAGCTATTGC
GAGAACATTGGTGACGATGGAATGCTACCCGTTATGCAAAATTGTATTGGGCTGAAAAGTGTCGATTTGGACAAT
ACTCGCATTAGCGATCGGGTCCTTCTCGAAGCTACTACTCTGGTCCTGGAGCGGTCGAGCCTATCAACAAATGCA
AACACGAAGCCGAAATTTACGCTACAGCTTGCCGTTTATGACTGCCAACACGTCACTTGGAAAGGGATACGCGAG
ATACTTTTCCGTAACGCGCAAGTCTGGTCCAAGTTGGATGTACATGGACCCACGGTGTACCCTACAGAAGCAATT
GCGCTCAAATGTTTCTATGGCTTTCAGATGACTGTTGATGAGCACCAGAAGCGTGTTTTACAGGGTGATTTTGGC
TCGGCTAACAGATTGGAGAGGAAGTGGTCTGAGTACATGCGAGCCAAGGAGGATGCTGAAGCGGATGTGACAGCT
TACGGGAGGTGGCGTCGTCGGGCTAGAGAGGCCCAGGCAGCACATTTGGAAGAGGAGGATGGAAGTATGGGCGGT
CGCCGAAGAGCCCGGACACTTGAAGCCTGTTTGGTTATGTGA
Transcript >OphauG2|1014
ATGGCTGCTGGTGCGCCGTCAAGCACCCGCCTCCACCTTGATCCATCGACGCCTGAGCTGCCCAACAAGCTAAAA
GGCCGTCACCGCCTGCTTCGGGAACTGCAGCGCATTTCTTCTTCGCCATCGCTCAATAGTCTTCGACGCTCGAAA
TCGGTTGGCAATCCCTACAGCACTCGAGGCACCCTTTCCTGTGTCAGCTTGGCCGCCCCGGGTCCCTCCCAGATG
CCACCTGCTCCTCGATACCCTTCACCATTGGCCTCGCAGACATCTTCTCATTCGATACCCACTGCTCCCATGTCG
CTGCGCACTCCGACCGCAGCCGGCGACTCGCCATTGTGCAGCAACCCCTCCCAAGACTATCTGGCTGCTCGAAAG
ATTGGAAACACCATCTCGTCTTCCTCTCCTGCCATTTCCACCTTGCCCATGGACCTCCGGTGCTCGAGGCTTGAA
AGACAACAGAGCCGCAACCGCTCAAATTGCCAAGCCCTGCAAAGACGACGCTTCTCTTTCTGGGACAGTATGCCC
TATGAAATGTCGATTCAAATCTTTTCCCATTTGAAACCAAAGGAGCTGGTCCGGGCATCGAGAGTGAGCAAGCTG
TTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACAACGCTGGATGCATCCGGCTTTTATCGAGAAATCCCCGCC
GAGTCTCTCACCAGAATCATCCTGGCTGCTGGTCCCTTTCTTAAAAACTTGAATCTTCGAGGCTGTGTGCAGATT
GAACACTACAAACGTACAGAAGCCATCATCAGTGCCTGCAGTAATCTCATCAACGCCACACTAGAGGGCTGCCAC
AACTTTCCAAAGGGCGCGGTCCACAGTCTATTGAAGAGCAATGGGAATCTGGTTCACCTCAACCTCACCGGGCTC
TCTGCTGTTACAAACTCGTCTTGTCGACTAATTGCCCAGTCGTGCCCTCGCCTGGAGTCGCTCAATGTGTCGTGG
TGCGAAAAGATTAGGGCGCGTGGCATCAAGGCCGTCATCGAATCGTGCCCCAGGCTGAAGGACCTGAGAGCCGGT
GAAGTCCGCGGATTCGATGATGTTGCCGTTGCCAGATGCATCTTCCAGTCAAACAACCTGGAAAAGCTAGTCCTG
TGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATTATGATGCACGGCGATGACCCAGAGATCGATATTCTG
ACATACAAGCCCCTCGTACCCCCTCGAAAACTGCGTCATCTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAA
GGAGTCAAAGCCATTGCCCACGTCACCCCCTATCTACAAGGGCTACAGCTTTCCGGATGCAAGTCCTTGACAGAC
GCAGCAGTCGAGCCTATTCTAGCTTCGACGCCCAGGCTCACATTGCTGGATCTCGAGGAGATGGCCCAATTGACC
AACTCATTACTTGCCAATCACTTGGCCAAATCTCCTTGTACCTCCAAGCTAGAGCATCTATCTCTGAGCTATTGC
GAGAACATTGGTGACGATGGAATGCTACCCGTTATGCAAAATTGTATTGGGCTGAAAAGTGTCGATTTGGACAAT
ACTCGCATTAGCGATCGGGTCCTTCTCGAAGCTACTACTCTGGTCCTGGAGCGGTCGAGCCTATCAACAAATGCA
AACACGAAGCCGAAATTTACGCTACAGCTTGCCGTTTATGACTGCCAACACGTCACTTGGAAAGGGATACGCGAG
ATACTTTTCCGTAACGCGCAAGTCTGGTCCAAGTTGGATGTACATGGACCCACGGTGTACCCTACAGAAGCAATT
GCGCTCAAATGTTTCTATGGCTTTCAGATGACTGTTGATGAGCACCAGAAGCGTGTTTTACAGGGTGATTTTGGC
TCGGCTAACAGATTGGAGAGGAAGTGGTCTGAGTACATGCGAGCCAAGGAGGATGCTGAAGCGGATGTGACAGCT
TACGGGAGGTGGCGTCGTCGGGCTAGAGAGGCCCAGGCAGCACATTTGGAAGAGGAGGATGGAAGTATGGGCGGT
CGCCGAAGAGCCCGGACACTTGAAGCCTGTTTGGTTATGTGA
Gene >OphauG2|1014
ATGGCTGCTGGTGCGCCGTCAAGCACCCGCCTCCACCTTGATCCATCGACGCCTGAGCTGCCCAACAAGCTAAAA
GGCCGTCACCGCCTGCTTCGGGAACTGCAGCGCATTTCTTCTTCGCCATCGCTCAATAGTCTTCGACGCTCGAAA
TCGGTTGGCAATCCCTACAGCACTCGAGGCACCCTTTCCTGTGTCAGCTTGGCCGCCCCGGGTCCCTCCCAGATG
CCACCTGCTCCTCGATACCCTTCACCATTGGCCTCGCAGACATCTTCTCATTCGATACCCACTGCTCCCATGTCG
CTGCGCACTCCGACCGCAGCCGGCGACTCGCCATTGTGCAGCAACCCCTCCCAAGACTATCTGGCTGCTCGAAAG
ATTGGAAACACCATCTCGTCTTCCTCTCCTGCCATTTCCACCTTGCCCATGGACCTCCGGTGCTCGAGGCTTGAA
AGACAACAGAGCCGCAACCGCTCAAATTGCCAAGCCCTGCAAAGACGACGCTTCTCTTTCTGGGACAGTATGCCC
TATGAAATGTCGATTCAAATCTTTTCCCATTTGAAACCAAAGGAGCTGGTCCGGGCATCGAGAGTGAGCAAGCTG
TTTCATCAGTTCTGCTTCGATGGTCAGCTCTGGACAACGCTGGATGCATCCGGCTTTTATCGAGAAATCCCCGCC
GAGTCTCTCACCAGAATCATCCTGGCTGCTGGTCCCTTTCTTAAAAACTTGAATCTTCGAGGCTGTGTGCAGATT
GAACACTACAAACGTACAGAAGCCATCATCAGTGCCTGCAGTAATCTCATCAACGCCACACTAGAGGGCTGCCAC
AACTTTCCAAAGGGCGCGGTCCACAGTCTATTGAAGAGCAATGGGAATCTGGTTCACCTCAACCTCACCGGGCTC
TCTGCTGTTACAAACTCGTCTTGTCGACTAATTGCCCAGTCGTGCCCTCGCCTGGAGTCGCTCAATGTGTCGTGG
TGCGAAAAGATTAGGGCGCGTGGCATCAAGGCCGTCATCGAATCGTGCCCCAGGCTGAAGGACCTGAGAGCCGGT
GAAGTCCGCGGATTCGATGATGTTGCCGTTGCCAGATGCATCTTCCAGTCAAACAACCTGGAAAAGCTAGTCCTG
TGTGGATGCCTGGAGCTTAGCGACGATGCGCTCAGAATTATGATGCACGGCGATGACCCAGAGATCGATATTCTG
ACATACAAGCCCCTCGTACCCCCTCGAAAACTGCGTCATCTTGACCTAAGTCGTTGCCATCGTCTTTCGAGCGAA
GGAGTCAAAGCCATTGCCCACGTCACCCCCTATCTACAAGGGCTACAGCTTTCCGGATGCAAGTCCTTGACAGAC
GCAGCAGTCGAGCCTATTCTAGCTTCGACGCCCAGGCTCACATTGCTGGATCTCGAGGAGATGGCCCAATTGACC
AACTCATTACTTGCCAATCACTTGGCCAAATCTCCTTGTACCTCCAAGCTAGAGCATCTATCTCTGAGCTATTGC
GAGAACATTGGTGACGATGGAATGCTACCCGTTATGCAAAATTGTATTGGGCTGAAAAGTGTCGATTTGGACAAT
ACTCGCATTAGCGATCGGGTCCTTCTCGAAGCTACTACTCTGGTCCTGGAGCGGTCGAGCCTATCAACAAATGCA
AACACGAAGCCGAAATTTACGCTACAGCTTGCCGTTTATGACTGCCAACACGTCACTTGGAAAGGGATACGCGAG
ATACTTTTCCGTAACGCGCAAGTCTGGTCCAAGTTGGATGTACATGGACCCACGGTGTACCCTACAGAAGCAATT
GCGCTCAAATGTTTCTATGGCTTTCAGATGACTGTTGATGAGCACCAGAAGCGTGTTTTACAGGGTGATTTTGGC
TCGGCTAACAGATTGGAGAGGAAGTGGTCTGAGTACATGCGAGCCAAGGAGGATGCTGAAGCGGATGTGACAGCT
TACGGGAGGTGGCGTCGTCGGGCTAGAGAGGCCCAGGCAGCACATTTGGAAGAGGAGGATGGAAGTATGGGCGGT
CGCCGAAGAGCCCGGACACTTGAAGCCTGTTTGGTTATGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail