Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1006
Gene name
LocationContig_1271:475..4179
Strand+
Gene length (bp)3704
Transcript length (bp)3147
Coding sequence length (bp)3147
Protein length (aa) 1049

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12009 Telomerase_RBD Telomerase ribonucleoprotein complex - RNA binding domain 3.2E-46 475 610
PF00078 RVT_1 Reverse transcriptase (RNA-dependent DNA polymerase) 1.3E-09 840 923

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13339|TERT_SCHPO Telomerase reverse transcriptase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trt1 PE=1 SV=1 116 1040 7.0E-79
sp|Q27ID4|TERT_BOVIN Telomerase reverse transcriptase OS=Bos taurus GN=TERT PE=3 SV=2 378 1039 6.0E-73
sp|O14746|TERT_HUMAN Telomerase reverse transcriptase OS=Homo sapiens GN=TERT PE=1 SV=1 361 1036 1.0E-72
sp|Q6A548|TERT_CANLF Telomerase reverse transcriptase OS=Canis lupus familiaris GN=TERT PE=2 SV=1 378 1048 5.0E-69
sp|Q1PS67|TERT_ORYLA Telomerase reverse transcriptase OS=Oryzias latipes GN=tert PE=1 SV=2 438 1039 2.0E-67
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13339|TERT_SCHPO Telomerase reverse transcriptase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trt1 PE=1 SV=1 116 1040 7.0E-79
sp|Q27ID4|TERT_BOVIN Telomerase reverse transcriptase OS=Bos taurus GN=TERT PE=3 SV=2 378 1039 6.0E-73
sp|O14746|TERT_HUMAN Telomerase reverse transcriptase OS=Homo sapiens GN=TERT PE=1 SV=1 361 1036 1.0E-72
sp|Q6A548|TERT_CANLF Telomerase reverse transcriptase OS=Canis lupus familiaris GN=TERT PE=2 SV=1 378 1048 5.0E-69
sp|Q1PS67|TERT_ORYLA Telomerase reverse transcriptase OS=Oryzias latipes GN=tert PE=1 SV=2 438 1039 2.0E-67
sp|O70372|TERT_MOUSE Telomerase reverse transcriptase OS=Mus musculus GN=Tert PE=1 SV=1 460 1040 4.0E-63
sp|Q673L6|TERT_RAT Telomerase reverse transcriptase OS=Rattus norvegicus GN=Tert PE=2 SV=1 361 1036 8.0E-62
sp|Q4KTA7|TERT_TAKRU Telomerase reverse transcriptase OS=Takifugu rubripes GN=tert PE=1 SV=1 471 1023 7.0E-61
sp|Q8LKW0|TERT_ORYSJ Telomerase reverse transcriptase OS=Oryza sativa subsp. japonica GN=TERT PE=2 SV=2 438 1033 1.0E-53
sp|O76332|TERT_OXYTR Telomerase reverse transcriptase OS=Oxytricha trifallax GN=TERT PE=3 SV=1 466 1030 2.0E-46
sp|Q9SPU7|TERT_ARATH Telomerase reverse transcriptase OS=Arabidopsis thaliana GN=TERT PE=1 SV=1 427 1032 1.0E-36
sp|O00939|TERT_EUPAE Telomerase reverse transcriptase OS=Euplotes aediculatus PE=3 SV=1 464 1003 9.0E-35
sp|O77448|TERT_TETTH Telomerase reverse transcriptase OS=Tetrahymena thermophila GN=TERT PE=1 SV=1 462 964 8.0E-27
sp|Q06163|TERT_YEAST Telomerase reverse transcriptase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EST2 PE=1 SV=2 443 1017 2.0E-22
[Show less]

GO

GO Term Description Terminal node
GO:0003964 RNA-directed DNA polymerase activity Yes
GO:0003674 molecular_function No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0016740 transferase activity No
GO:0140097 catalytic activity, acting on DNA No
GO:0034061 DNA polymerase activity No
GO:0003824 catalytic activity No
GO:0016779 nucleotidyltransferase activity No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1006
MNRGLKRKRDVDASHVEQANSLESPVGRQVLHDCYANVWTLRDYLLCRLPSSSRLRRKKIACLGRHVDQDLAHLL
QTTLVCFAEPASETNPTVFKQFLAFSQGTDNASTCSWNLASSPTEAQSEIVDFVIWLLFKRATSQTPLPKHMLCH
GFRRRFRQGDSSNTAIPGLYSLYANPYAEALKQPPWPQLLALLGQSGHKTMVDLLLDCSLFVTLEAGISNYIQIA
GCPLSALDAAFSNTQADSTKPVRKGSEITLLRHRVFYGKPTLSARGHLQPGFKHIHVLNRCPYIRPYIQSSQDHA
SSDKSAQNEANTTHVLMYIFPRQFGLHNVFTSTVNCPQTSQRLQDYTLRDMSDLKLAKHRGPDAQLVKVPKRLRG
AARQLVRRLQILHGRCSYSELLHHYCPTYLDRHEGCATEIDASFVPASYVSASNAGTNPVSNVSGSALKRPRKMH
HRTWQSMALPPMAESLVELACPHSHVSAFCQGALARILPDEMWGDSDTRHHNKKTFLHNVDRFIKLRRFESMTLH
QISQGLKMSEIAWLKQPGARDRPCQSETNKRLEIFLEFLYYVFDSLLMPLIKNNFYVTESNTHRNQVFYFRHDIW
RLIAEPKMADLKRDMLEEVNAAQTCDLLASRQLGFSQMRLVPKGHKMRPIMNLQKRVANKASSKFLSPSINSTLR
PLHAVLKYEKEINPSRLGSALPSIDRIRPLLADFKASLGATNHDLYFVKMDVRAAFDTIPQQAVVSLMGDILSRN
RYEIRKHAEIKPGQQLPHGSHKTRALRRWHTSAHDAEDGESLANQLKQGIWANKTNTIFVENAFQKTYEATALLS
LLAEHVQANLVKVGKKLYRQKTGIPQGSILSSLLCDYIYAELEQRQLAFLDSADCLLMRTVDDFVLITSAKSKAL
EFVKKMHRGIPQYGVEINQEKTLVNFEMTINGSRIASISDDAMFPYCGVLIDCKTLELAKDQSRNKGIALENTLT
VDLCRYPGQNFQRKVLGAFIIQSGPMFFDTHFNSTKRVLASLREAMVLTCRKMCAYLRCLPKPQRPGSSIIIR*
Coding >OphauG2|1006
ATGAACAGAGGACTCAAGCGCAAGCGCGACGTGGACGCGTCCCACGTCGAGCAAGCGAATAGCCTCGAGTCGCCT
GTTGGCCGCCAAGTCCTCCATGACTGCTACGCCAACGTCTGGACGCTGCGGGACTACCTGCTCTGCAGGCTGCCG
TCGAGCTCGAGGCTCCGTCGCAAAAAGATTGCATGTCTGGGCCGCCATGTCGACCAGGATTTGGCCCATCTCCTG
CAAACGACGCTTGTCTGCTTTGCCGAGCCGGCTTCCGAGACCAATCCCACTGTTTTCAAGCAGTTCCTAGCCTTT
TCTCAAGGCACCGACAACGCTAGCACCTGCTCATGGAATCTCGCGAGCTCGCCAACCGAGGCTCAGTCCGAGATT
GTCGATTTTGTCATTTGGCTCCTCTTCAAAAGGGCAACGTCACAGACGCCATTGCCAAAGCACATGCTTTGCCAT
GGCTTTCGTAGGCGATTCAGACAGGGAGACTCGTCCAACACGGCCATTCCCGGTCTGTACAGTCTCTATGCCAAC
CCGTACGCCGAGGCGCTCAAGCAGCCTCCTTGGCCCCAGTTGTTGGCACTGCTTGGCCAGTCCGGTCATAAAACC
ATGGTAGATCTGCTCCTTGACTGCTCCCTCTTCGTAACGCTGGAAGCTGGCATCAGCAATTACATTCAGATAGCT
GGATGTCCTCTATCTGCACTTGACGCCGCCTTCAGCAACACGCAAGCCGATTCAACCAAGCCAGTGAGAAAGGGC
TCAGAGATTACACTGCTTCGCCATCGAGTTTTTTATGGGAAGCCCACGCTATCTGCTCGTGGCCATCTTCAGCCA
GGCTTCAAGCATATCCATGTCCTCAATCGATGCCCCTATATTCGTCCCTATATCCAGTCTAGTCAAGACCATGCG
TCGTCAGACAAGAGCGCCCAGAATGAAGCAAATACGACTCATGTTTTGATGTATATATTCCCTCGACAGTTTGGG
CTGCACAACGTCTTCACTTCGACGGTCAACTGCCCACAAACAAGTCAACGGCTTCAAGACTACACATTGCGAGAC
ATGTCAGACTTGAAACTCGCCAAGCATCGAGGCCCCGACGCCCAGCTGGTCAAGGTGCCAAAGAGACTGAGAGGC
GCTGCACGGCAGCTTGTGAGACGACTTCAGATTCTTCATGGCCGCTGCTCCTACTCGGAACTGCTGCACCACTAC
TGTCCAACCTATCTTGACCGCCATGAGGGGTGCGCTACCGAGATTGACGCTTCTTTTGTACCAGCCTCATATGTG
AGCGCAAGCAATGCTGGCACGAACCCTGTCTCGAATGTCTCGGGCTCCGCGCTCAAACGCCCTCGCAAGATGCAT
CATCGAACTTGGCAGTCGATGGCTCTCCCACCCATGGCAGAGTCCCTGGTGGAACTAGCTTGTCCTCATTCTCAC
GTTTCGGCCTTCTGTCAAGGCGCCTTGGCTCGCATTTTACCAGATGAGATGTGGGGTGACAGTGATACACGGCAC
CACAACAAGAAGACGTTTCTGCACAATGTAGACCGCTTCATCAAACTACGGCGCTTTGAGTCGATGACGTTGCAC
CAAATTTCTCAGGGTCTCAAGATGAGCGAGATAGCTTGGTTGAAACAACCTGGGGCCAGAGATCGGCCTTGTCAA
AGCGAGACCAACAAGCGACTCGAGATATTTCTCGAGTTTCTATACTATGTGTTCGACTCGCTGTTGATGCCTCTG
ATCAAGAACAACTTTTACGTGACAGAGTCAAACACACACCGCAATCAAGTCTTTTATTTTCGCCATGATATATGG
AGGCTAATTGCAGAGCCTAAAATGGCTGATCTTAAGAGGGATATGCTGGAGGAGGTCAATGCGGCACAAACATGT
GACCTTCTGGCCTCGAGACAACTTGGCTTCAGTCAGATGAGACTGGTGCCCAAGGGCCATAAAATGCGGCCCATT
ATGAATCTTCAAAAACGAGTTGCCAACAAAGCATCAAGCAAGTTCTTGAGCCCGAGTATCAACTCTACACTCAGA
CCGCTTCATGCTGTACTCAAGTATGAAAAGGAAATAAATCCGTCGAGACTAGGCTCTGCTTTGCCTTCGATTGAC
AGAATTCGCCCGCTTCTGGCGGATTTCAAGGCATCTCTGGGAGCTACAAATCATGACCTTTACTTTGTCAAGATG
GACGTGCGAGCCGCGTTCGACACGATTCCTCAACAAGCTGTGGTTTCTCTCATGGGCGATATACTCTCGAGGAAT
CGTTACGAGATTAGGAAACACGCTGAGATCAAGCCTGGGCAGCAGCTGCCGCATGGCTCACACAAGACTCGAGCT
CTCCGACGCTGGCACACCTCGGCCCACGATGCTGAAGACGGCGAATCACTTGCTAATCAGCTCAAGCAGGGGATT
TGGGCAAACAAGACGAACACCATTTTTGTCGAAAACGCCTTTCAAAAAACGTACGAGGCAACGGCTCTCTTGAGT
TTATTGGCCGAGCACGTCCAGGCCAACTTGGTCAAGGTCGGCAAGAAACTGTACAGGCAAAAGACAGGTATACCG
CAAGGCTCCATCTTGTCAAGCTTACTGTGTGACTACATTTACGCAGAGCTGGAGCAGCGGCAACTGGCATTTCTG
GACTCGGCCGATTGTCTGCTGATGCGAACAGTGGACGACTTTGTGCTCATCACGTCTGCCAAGTCCAAGGCCCTC
GAGTTTGTGAAGAAGATGCATCGGGGCATACCTCAATACGGAGTCGAAATAAATCAAGAAAAGACACTAGTGAAC
TTTGAAATGACAATTAATGGCAGCAGGATTGCTTCAATCTCGGATGACGCCATGTTTCCGTATTGTGGCGTCTTG
ATTGACTGCAAGACGCTAGAGCTGGCAAAGGATCAGAGCCGTAACAAAGGCATAGCTCTCGAGAATACATTGACA
GTCGACCTTTGCCGATATCCAGGCCAGAATTTTCAGAGAAAGGTGCTTGGTGCCTTCATCATCCAGTCTGGCCCA
ATGTTCTTTGACACGCACTTCAACTCGACCAAAAGAGTCTTGGCCTCTTTGCGTGAGGCCATGGTGCTGACGTGC
CGCAAAATGTGCGCTTACCTGCGCTGCCTGCCCAAGCCACAACGGCCCGGGAGCAGCATCATTATCCGTTAG
Transcript >OphauG2|1006
ATGAACAGAGGACTCAAGCGCAAGCGCGACGTGGACGCGTCCCACGTCGAGCAAGCGAATAGCCTCGAGTCGCCT
GTTGGCCGCCAAGTCCTCCATGACTGCTACGCCAACGTCTGGACGCTGCGGGACTACCTGCTCTGCAGGCTGCCG
TCGAGCTCGAGGCTCCGTCGCAAAAAGATTGCATGTCTGGGCCGCCATGTCGACCAGGATTTGGCCCATCTCCTG
CAAACGACGCTTGTCTGCTTTGCCGAGCCGGCTTCCGAGACCAATCCCACTGTTTTCAAGCAGTTCCTAGCCTTT
TCTCAAGGCACCGACAACGCTAGCACCTGCTCATGGAATCTCGCGAGCTCGCCAACCGAGGCTCAGTCCGAGATT
GTCGATTTTGTCATTTGGCTCCTCTTCAAAAGGGCAACGTCACAGACGCCATTGCCAAAGCACATGCTTTGCCAT
GGCTTTCGTAGGCGATTCAGACAGGGAGACTCGTCCAACACGGCCATTCCCGGTCTGTACAGTCTCTATGCCAAC
CCGTACGCCGAGGCGCTCAAGCAGCCTCCTTGGCCCCAGTTGTTGGCACTGCTTGGCCAGTCCGGTCATAAAACC
ATGGTAGATCTGCTCCTTGACTGCTCCCTCTTCGTAACGCTGGAAGCTGGCATCAGCAATTACATTCAGATAGCT
GGATGTCCTCTATCTGCACTTGACGCCGCCTTCAGCAACACGCAAGCCGATTCAACCAAGCCAGTGAGAAAGGGC
TCAGAGATTACACTGCTTCGCCATCGAGTTTTTTATGGGAAGCCCACGCTATCTGCTCGTGGCCATCTTCAGCCA
GGCTTCAAGCATATCCATGTCCTCAATCGATGCCCCTATATTCGTCCCTATATCCAGTCTAGTCAAGACCATGCG
TCGTCAGACAAGAGCGCCCAGAATGAAGCAAATACGACTCATGTTTTGATGTATATATTCCCTCGACAGTTTGGG
CTGCACAACGTCTTCACTTCGACGGTCAACTGCCCACAAACAAGTCAACGGCTTCAAGACTACACATTGCGAGAC
ATGTCAGACTTGAAACTCGCCAAGCATCGAGGCCCCGACGCCCAGCTGGTCAAGGTGCCAAAGAGACTGAGAGGC
GCTGCACGGCAGCTTGTGAGACGACTTCAGATTCTTCATGGCCGCTGCTCCTACTCGGAACTGCTGCACCACTAC
TGTCCAACCTATCTTGACCGCCATGAGGGGTGCGCTACCGAGATTGACGCTTCTTTTGTACCAGCCTCATATGTG
AGCGCAAGCAATGCTGGCACGAACCCTGTCTCGAATGTCTCGGGCTCCGCGCTCAAACGCCCTCGCAAGATGCAT
CATCGAACTTGGCAGTCGATGGCTCTCCCACCCATGGCAGAGTCCCTGGTGGAACTAGCTTGTCCTCATTCTCAC
GTTTCGGCCTTCTGTCAAGGCGCCTTGGCTCGCATTTTACCAGATGAGATGTGGGGTGACAGTGATACACGGCAC
CACAACAAGAAGACGTTTCTGCACAATGTAGACCGCTTCATCAAACTACGGCGCTTTGAGTCGATGACGTTGCAC
CAAATTTCTCAGGGTCTCAAGATGAGCGAGATAGCTTGGTTGAAACAACCTGGGGCCAGAGATCGGCCTTGTCAA
AGCGAGACCAACAAGCGACTCGAGATATTTCTCGAGTTTCTATACTATGTGTTCGACTCGCTGTTGATGCCTCTG
ATCAAGAACAACTTTTACGTGACAGAGTCAAACACACACCGCAATCAAGTCTTTTATTTTCGCCATGATATATGG
AGGCTAATTGCAGAGCCTAAAATGGCTGATCTTAAGAGGGATATGCTGGAGGAGGTCAATGCGGCACAAACATGT
GACCTTCTGGCCTCGAGACAACTTGGCTTCAGTCAGATGAGACTGGTGCCCAAGGGCCATAAAATGCGGCCCATT
ATGAATCTTCAAAAACGAGTTGCCAACAAAGCATCAAGCAAGTTCTTGAGCCCGAGTATCAACTCTACACTCAGA
CCGCTTCATGCTGTACTCAAGTATGAAAAGGAAATAAATCCGTCGAGACTAGGCTCTGCTTTGCCTTCGATTGAC
AGAATTCGCCCGCTTCTGGCGGATTTCAAGGCATCTCTGGGAGCTACAAATCATGACCTTTACTTTGTCAAGATG
GACGTGCGAGCCGCGTTCGACACGATTCCTCAACAAGCTGTGGTTTCTCTCATGGGCGATATACTCTCGAGGAAT
CGTTACGAGATTAGGAAACACGCTGAGATCAAGCCTGGGCAGCAGCTGCCGCATGGCTCACACAAGACTCGAGCT
CTCCGACGCTGGCACACCTCGGCCCACGATGCTGAAGACGGCGAATCACTTGCTAATCAGCTCAAGCAGGGGATT
TGGGCAAACAAGACGAACACCATTTTTGTCGAAAACGCCTTTCAAAAAACGTACGAGGCAACGGCTCTCTTGAGT
TTATTGGCCGAGCACGTCCAGGCCAACTTGGTCAAGGTCGGCAAGAAACTGTACAGGCAAAAGACAGGTATACCG
CAAGGCTCCATCTTGTCAAGCTTACTGTGTGACTACATTTACGCAGAGCTGGAGCAGCGGCAACTGGCATTTCTG
GACTCGGCCGATTGTCTGCTGATGCGAACAGTGGACGACTTTGTGCTCATCACGTCTGCCAAGTCCAAGGCCCTC
GAGTTTGTGAAGAAGATGCATCGGGGCATACCTCAATACGGAGTCGAAATAAATCAAGAAAAGACACTAGTGAAC
TTTGAAATGACAATTAATGGCAGCAGGATTGCTTCAATCTCGGATGACGCCATGTTTCCGTATTGTGGCGTCTTG
ATTGACTGCAAGACGCTAGAGCTGGCAAAGGATCAGAGCCGTAACAAAGGCATAGCTCTCGAGAATACATTGACA
GTCGACCTTTGCCGATATCCAGGCCAGAATTTTCAGAGAAAGGTGCTTGGTGCCTTCATCATCCAGTCTGGCCCA
ATGTTCTTTGACACGCACTTCAACTCGACCAAAAGAGTCTTGGCCTCTTTGCGTGAGGCCATGGTGCTGACGTGC
CGCAAAATGTGCGCTTACCTGCGCTGCCTGCCCAAGCCACAACGGCCCGGGAGCAGCATCATTATCCGTTAG
Gene >OphauG2|1006
ATGAACAGAGGACTCAAGCGCAAGCGCGACGTGGACGCGTCCCACGTCGAGCAAGCGAATAGCCTCGAGTCGCCT
GTTGGCCGCCAAGTCCTCCATGACTGCTACGCCAACGTCTGGACGCTGCGGGACTACCTGCTCTGCAGGCTGCCG
TCGAGCTCGAGGCTCCGTCGCAAAAAGATTGCATGTCTGGGCCGCCATGTCGACCAGGATTTGGCCCATCTCCTG
CAAACGACGCTTGTCTGCTTTGCCGAGCCGGCTTCCGAGACCAATCCCACTGTTTTCAAGCAGTTCCTAGCCTTT
TCTCAAGGCACCGACAACGCTAGCACCTGCTCATGGAATCTCGCGAGCTCGCCAACCGAGGCTCAGTCCGAGGTG
TGTGAGCCTTGGTTGCCCTGCTGCATCCTACACCTCGTTGGCTCACCCGTCTCAGATTGTCGATTTTGTCATTTG
GCTCCTCTTCAAAAGGGCAACGTCACAGACGCCATTGCCAAAGCACATGCTTTGCCATGGCTTTCGTAGGCGATT
CAGACAGGGAGACTCGTCCAACACGGCCATTCCCGGTCTGTACAGTCTCTATGCCAACCCGTACGCCGAGGCGCT
CAAGCAGCCTCCTTGGCCCCAGTTGTTGGCACTGCTTGGCCAGTCCGGTCATAAAACCATGGTAGATCTGCTCCT
TGACTGCTCCCTCTTCGTAACGCTGGAAGCTGGCATCAGCAATTACATTCAGATAGCTGGTGAGCCTTTTCGACT
TGTCCTGGAAATGCAAAAAATTCCTTAACAGCAAAATAATTTGCAGGATGTCCTCTATCTGCACTTGACGCCGCC
TTCAGCAACACGCAAGCCGATTCAACCAAGCCAGTGAGAAAGGGCTCAGAGATTACACTGCTTCGCCATCGAGTT
TTTTATGGGAAGCCCACGCTATCTGCTCGTGGCCATCTTCAGCCAGGCTTCAAGCATATCCGTATTGCTCGCCCG
ACCTCGTCTTGCTCCAGCTGGCTTTGGTCTAACACTGGCTTTGCAATAGATGTCCTCAATCGATGCCCCTATATT
CGTCCCTATATCCAGTCTAGTCAAGACCATGCGTCGTCAGACAAGAGCGCCCAGAATGAAGCAAATACGACTCAT
GTTTTGATGTATATATTCCCTCGACAGTTTGGGCTGCACAACGTCTTCACTTCGACGGTCAACTGCCCACAAACA
AGTCAACGGCTTCAAGACTACACATTGCGAGACATGTCAGACTTGAAACTCGCCAAGCATCGAGGCCCCGACGCC
CAGCTGGTCAAGGTGCCAAAGAGACTGAGAGGCGCTGCACGGCAGCTTGTGAGACGACTTCAGATTCTTCATGGC
CGCTGCTCCTACTCGGAACTGCTGCACCACTACTGTCCAACCTATCTTGACCGCCATGAGGGGTGCGCTACCGAG
ATTGACGCTTCTTTTGTACCAGCCTCATATGTGAGCGCAAGCAATGCTGGCACGAACCCTGTCTCGAATGTCTCG
GGCTCCGCGCTCAAACGCCCTCGCAAGATGCATCATCGAACTTGGCAGTCGATGGCTCTCCCACCCATGGCAGAG
TCCCTGGTGGAACTAGCTTGTCCTCATTCTCACGTTTCGGCCTTCTGTCAAGGCGCCTTGGCTCGCATTTTACCA
GATGAGATGTGGGGTGACAGTGATACACGGCACCACAACAAGAAGACGTTTCTGCACAATGTAGACCGCTTCATC
AAACTACGGCGCTTTGAGTCGATGACGTTGCACCAAATTTCTCAGGGTCTCAAGGTAAGTCAGTTGCACACAACG
CACCAGGAGCCTTTCGCTTTGCCGAGAAGATCATGTCACCTAACTTGCGAGGCTTGACAGATGAGCGAGATAGCT
TGGTTGAAACAACCTGGGGCCAGAGATCGGCCTTGTCAAAGCGAGACCAACAAGCGACTCGAGATATTTCTCGAG
TTTCTATACTATGTGTTCGACTCGCTGTTGATGCCTCTGATCAAGAACAACTTTTACGTGACAGAGTCAAACACA
CACCGCAATCAAGTCTTTTATTTTCGCCATGATATATGGAGGCTAATTGCAGAGCCTAAAATGGCTGATCTTAAG
AGGGATATGCTGGAGGAGGTCAATGCGGCACAAACATGTGACCTTCTGGCCTCGAGACAACTTGGCTTCAGTCAG
ATGAGACTGGTGCCCAAGGGCCATAAAATGCGGCCCATTATGAATCTTCAAAAACGAGTTGCCAACAAAGCATCA
AGCAAGTTCTTGAGCCCGAGTATCAACTCTACACTCAGACCGCTTCATGCTGTACTCAAGTATGAAAAGGTGACA
TTTAAGTGCCAACCTTGAGCAACTAGACTGCCGTTTGACTGACTCGAAATTTCAAGGAAATAAATCCGTCGAGAC
TAGGCTCTGCTTTGCCTTCGATTGACAGAATTCGCCCGCTTCTGGCGGATTTCAAGGCATCTCTGGGAGCTACAA
ATCATGACCTTTACTTTGTCAAGATGGACGTGCGAGCCGCGTTCGACACGATTCCTCAACAAGCTGTGGTTTCTC
TCATGGGCGATATACTCTCGAGGAATCGTTACGAGATTAGGAAACACGCTGAGATCAAGCCTGGGCAGCAGCTGC
CGCATGGCTCACACAAGACTCGAGCTCTCCGACGCTGGCACACCTCGGCCCACGATGCTGAAGACGGCGAATCAC
TTGCTAATCAGCTCAAGCAGGGGATTTGGGCAAACAAGACGAACACCATTTTTGTCGAAAACGCCTTTCAAAAAA
CGTACGAGGCAACGGCTCTCTTGAGTTTATTGGCCGAGCACGTCCAGGCCAACTTGGTCAAGGTCGGCAAGAAAC
TGTACAGGCAAAAGACAGGTATACCGCAAGGCTCCATCTTGTCAAGCTTACTGTGTGACTACATTTACGCAGAGC
TGGAGCAGCGGCAACTGGCATTTCTGGACTCGGCCGATTGTCTGCTGATGCGAACAGTGGACGACTTTGTGCTCA
TCACGTCTGCCAAGTCCAAGGCCCTCGAGTTTGTGAAGAAGATGCATCGGGGCATACCTCAATACGGAGTCGAAA
TAAATCAAGAAAAGACACTAGTGAACTTTGAAATGACAATTAATGGCAGCAGGATTGCTTCAATCTCGGATGACG
CCATGTTTCCGTATTGTGGCGTCTTGATTGACTGCAAGACGCTAGAGCTGGCAAAGGATCAGAGCCGTAACAAAG
GCATAGGTAAGTCGCAGAGAAGGAGGGAGAAGAGAGAGAGCGAGAGCGAGAGAGAGAGCATGCCAAAAGTCGCAT
GAATGGAAGCTCATCATGGCCTTGCAGCTCTCGAGAATACATTGACAGTCGACCTTTGCCGATATCCAGGCCAGA
ATTTTCAGAGAAAGGTGCTTGGTATGTTTTTGCCCCGACCTGTGTTTTCCCATTTGGTAAAACAGTCTTGGTGAC
ACGAGTCTTGTCATTTCTCTACCCTTTGTATCGATGTTTAAGCAGGATTCGACACATGTTGCTGACCTTGGACTA
TACCAGGTGCCTTCATCATCCAGTCTGGCCCAATGTTCTTTGACACGCACTTCAACTCGACCAAAAGAGTCTTGG
CCTCTTTGCGTGAGGCCATGGTGCTGACGTGCCGCAAAATGTGCGCTTACCTGCGCTGCCTGCCCAAGCCACAAC
GGCCCGGGAGCAGCATCATTATCCGTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail