Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauG2|1005
Gene name
LocationContig_1270:3642..4731
Strand+
Gene length (bp)1089
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13343 SBP_bac_6 Bacterial extracellular solute-binding protein 6.0E-09 114 299
PF13531 SBP_bac_11 Bacterial extracellular solute-binding protein 1.7E-08 161 298

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 18 0.999571

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5163
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1005 (this protein)
Ophiocordyceps australis map64 (Brazil) OphauB2|6438
Ophiocordyceps camponoti-rufipedis Ophun1|2680
Ophiocordyceps subramaniannii Hirsu2|3703
Ophiocordyceps subramaniannii Hirsu2|8019

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauG2|1005
MSVSLLAAALLLAPAVSADRLLGFNSAPLLETRSLDQIYQAALAEGGRVVCWHGGDERNQQDALKRAFEARFPNM
TLDISVDLSKYHDVRIDEQLAVGNVTVDSVILQTVHDYPRWAQQGALLNYAPQGFDQIHDDFKDSVSASYYGLEV
FYWQSIWNTQKTDGATFSTFADYLRPEFKDKLVLTYPNDDDAVLFAFDMIMQRNGTQFFDDLLAQNPHWVRGTAT
PLTLVSQDNNSYAATFTSAAGFKPEQQSINVAFPTDAMSVTWAQLGAIMAQAPHPEGAKLLHNYMLSPEFQESLG
GWSVRRDVPNPEGVPDLWSSPNLNPTLFSRWMENRANVERLRFWFEARLGTAPGVDPIDDEI*
Coding >OphauG2|1005
ATGTCCGTGTCGCTCCTTGCTGCAGCTCTGCTGCTAGCTCCCGCCGTGTCCGCCGACCGGCTGCTGGGCTTCAAC
AGCGCTCCGCTCCTGGAAACTCGCTCCCTTGACCAAATCTACCAAGCCGCACTAGCCGAAGGCGGCAGAGTCGTC
TGTTGGCACGGCGGCGACGAAAGGAATCAACAAGACGCGCTCAAGCGCGCCTTTGAAGCCCGGTTCCCAAACATG
ACGCTCGACATCTCCGTCGACCTGTCCAAGTACCACGACGTGCGCATTGACGAGCAGCTCGCAGTCGGCAACGTC
ACTGTCGACAGCGTCATTCTGCAAACCGTCCACGACTACCCCCGCTGGGCTCAGCAGGGCGCCCTGCTCAACTAT
GCGCCCCAGGGCTTCGACCAGATCCACGACGACTTCAAGGACTCGGTTTCCGCTTCCTACTATGGCCTCGAGGTC
TTTTACTGGCAGAGCATCTGGAACACCCAAAAGACGGACGGCGCCACCTTTTCCACATTTGCCGATTACCTGCGC
CCCGAGTTCAAGGACAAGCTCGTCCTCACCTATCCCAACGACGACGACGCCGTCCTCTTTGCCTTTGACATGATT
ATGCAGCGCAACGGCACCCAGTTCTTCGACGACTTGCTGGCCCAGAACCCTCACTGGGTTCGCGGCACCGCCACC
CCTCTAACCCTCGTCAGCCAGGACAACAACTCCTACGCCGCCACCTTTACCAGCGCCGCCGGCTTCAAGCCCGAG
CAGCAATCCATAAACGTCGCCTTTCCCACCGACGCCATGTCCGTCACCTGGGCCCAGCTCGGCGCCATCATGGCC
CAGGCCCCTCACCCCGAAGGCGCCAAGCTGCTGCACAACTACATGCTGTCCCCCGAATTCCAAGAATCCCTCGGC
GGCTGGAGCGTGCGCCGCGACGTCCCAAACCCCGAGGGCGTCCCAGACTTGTGGTCCAGCCCAAACCTCAACCCG
ACGCTCTTTAGCCGCTGGATGGAGAACCGCGCCAATGTCGAGCGACTGCGCTTCTGGTTTGAGGCGCGCCTCGGC
ACTGCTCCGGGCGTGGATCCTATCGACGATGAGATTTAA
Transcript >OphauG2|1005
ATGTCCGTGTCGCTCCTTGCTGCAGCTCTGCTGCTAGCTCCCGCCGTGTCCGCCGACCGGCTGCTGGGCTTCAAC
AGCGCTCCGCTCCTGGAAACTCGCTCCCTTGACCAAATCTACCAAGCCGCACTAGCCGAAGGCGGCAGAGTCGTC
TGTTGGCACGGCGGCGACGAAAGGAATCAACAAGACGCGCTCAAGCGCGCCTTTGAAGCCCGGTTCCCAAACATG
ACGCTCGACATCTCCGTCGACCTGTCCAAGTACCACGACGTGCGCATTGACGAGCAGCTCGCAGTCGGCAACGTC
ACTGTCGACAGCGTCATTCTGCAAACCGTCCACGACTACCCCCGCTGGGCTCAGCAGGGCGCCCTGCTCAACTAT
GCGCCCCAGGGCTTCGACCAGATCCACGACGACTTCAAGGACTCGGTTTCCGCTTCCTACTATGGCCTCGAGGTC
TTTTACTGGCAGAGCATCTGGAACACCCAAAAGACGGACGGCGCCACCTTTTCCACATTTGCCGATTACCTGCGC
CCCGAGTTCAAGGACAAGCTCGTCCTCACCTATCCCAACGACGACGACGCCGTCCTCTTTGCCTTTGACATGATT
ATGCAGCGCAACGGCACCCAGTTCTTCGACGACTTGCTGGCCCAGAACCCTCACTGGGTTCGCGGCACCGCCACC
CCTCTAACCCTCGTCAGCCAGGACAACAACTCCTACGCCGCCACCTTTACCAGCGCCGCCGGCTTCAAGCCCGAG
CAGCAATCCATAAACGTCGCCTTTCCCACCGACGCCATGTCCGTCACCTGGGCCCAGCTCGGCGCCATCATGGCC
CAGGCCCCTCACCCCGAAGGCGCCAAGCTGCTGCACAACTACATGCTGTCCCCCGAATTCCAAGAATCCCTCGGC
GGCTGGAGCGTGCGCCGCGACGTCCCAAACCCCGAGGGCGTCCCAGACTTGTGGTCCAGCCCAAACCTCAACCCG
ACGCTCTTTAGCCGCTGGATGGAGAACCGCGCCAATGTCGAGCGACTGCGCTTCTGGTTTGAGGCGCGCCTCGGC
ACTGCTCCGGGCGTGGATCCTATCGACGATGAGATTTAA
Gene >OphauG2|1005
ATGTCCGTGTCGCTCCTTGCTGCAGCTCTGCTGCTAGCTCCCGCCGTGTCCGCCGACCGGCTGCTGGGCTTCAAC
AGCGCTCCGCTCCTGGAAACTCGCTCCCTTGACCAAATCTACCAAGCCGCACTAGCCGAAGGCGGCAGAGTCGTC
TGTTGGCACGGCGGCGACGAAAGGAATCAACAAGACGCGCTCAAGCGCGCCTTTGAAGCCCGGTTCCCAAACATG
ACGCTCGACATCTCCGTCGACCTGTCCAAGTACCACGACGTGCGCATTGACGAGCAGCTCGCAGTCGGCAACGTC
ACTGTCGACAGCGTCATTCTGCAAACCGTCCACGACTACCCCCGCTGGGCTCAGCAGGGCGCCCTGCTCAACTAT
GCGCCCCAGGGCTTCGACCAGATCCACGACGACTTCAAGGACTCGGTTTCCGCTTCCTACTATGGCCTCGAGGTC
TTTTACTGGCAGAGCATCTGGAACACCCAAAAGACGGACGGCGCCACCTTTTCCACATTTGCCGATTACCTGCGC
CCCGAGTTCAAGGACAAGCTCGTCCTCACCTATCCCAACGACGACGACGCCGTCCTCTTTGCCTTTGACATGATT
ATGCAGCGCAACGGCACCCAGTTCTTCGACGACTTGCTGGCCCAGAACCCTCACTGGGTTCGCGGCACCGCCACC
CCTCTAACCCTCGTCAGCCAGGACAACAACTCCTACGCCGCCACCTTTACCAGCGCCGCCGGCTTCAAGCCCGAG
CAGCAATCCATAAACGTCGCCTTTCCCACCGACGCCATGTCCGTCACCTGGGCCCAGCTCGGCGCCATCATGGCC
CAGGCCCCTCACCCCGAAGGCGCCAAGCTGCTGCACAACTACATGCTGTCCCCCGAATTCCAAGAATCCCTCGGC
GGCTGGAGCGTGCGCCGCGACGTCCCAAACCCCGAGGGCGTCCCAGACTTGTGGTCCAGCCCAAACCTCAACCCG
ACGCTCTTTAGCCGCTGGATGGAGAACCGCGCCAATGTCGAGCGACTGCGCTTCTGGTTTGAGGCGCGCCTCGGC
ACTGCTCCGGGCGTGGATCCTATCGACGATGAGATTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail