Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|998
Gene name
LocationContig_122:862..1804
Strand+
Gene length (bp)942
Transcript length (bp)942
Coding sequence length (bp)942
Protein length (aa) 314

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12138 Spherulin4 Spherulation-specific family 4 2.4E-56 10 308

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P11113|SR4_PHYPO Spherulin-4 OS=Physarum polycephalum PE=2 SV=1 10 131 8.0E-16

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 23 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|998
MARDMVAPFILVPLYMYPLEQAWEPLFQAARAHREVRFVAVVNPASGPGAEALPDQSYIAALRRLADEPNIEAVG
YVYCSYGARQPAAVCADMEAYCGWRLDGQPVIGGVFFDEAPAGHDKVDWMHHLARHAHQTWRAQHDAQHDAQHDA
QHDAHDACPPVGETPAQDSKALDSKALDSKALVILNPGVAVPLAYFAHCHHVVVFEGSEAEWQRRCIDQPGLDPI
LRDHDALSKAVAIIHSTQQPPRRLHRLLSLFHNSSNKQHPACHAAHTLAQIRALGLMGVYLTDQLHGGYTRWPAA
WMQLADAVAQWQL*
Coding >OphauB2|998
ATGGCGCGCGACATGGTGGCCCCCTTCATCCTCGTGCCGCTCTACATGTACCCGCTGGAGCAGGCATGGGAGCCA
CTGTTCCAGGCGGCTCGCGCCCACCGTGAGGTGCGCTTCGTGGCGGTGGTGAATCCGGCCAGCGGACCCGGGGCT
GAGGCGCTTCCGGACCAGAGCTACATTGCGGCTCTACGGCGCTTGGCCGACGAGCCCAACATTGAGGCGGTTGGC
TATGTCTACTGCAGCTATGGCGCTCGCCAGCCTGCCGCCGTCTGTGCCGACATGGAGGCCTACTGCGGCTGGCGC
CTCGACGGGCAGCCCGTGATTGGGGGCGTCTTTTTTGACGAGGCGCCTGCTGGCCACGACAAGGTGGACTGGATG
CATCACCTGGCCCGTCACGCACACCAGACGTGGCGCGCCCAGCATGACGCCCAGCATGATGCCCAGCATGATGCC
CAGCATGACGCCCACGACGCCTGCCCGCCTGTGGGGGAGACGCCAGCCCAAGACTCCAAGGCCCTCGACTCCAAG
GCCCTCGACTCCAAGGCCCTCGTCATCCTCAACCCTGGCGTTGCCGTGCCTCTGGCCTACTTTGCCCACTGCCAC
CACGTCGTCGTCTTTGAGGGCTCCGAGGCTGAGTGGCAGCGCCGCTGCATCGACCAGCCTGGCCTTGACCCCATT
CTCCGCGACCACGACGCTCTCTCCAAGGCCGTCGCCATTATCCACTCCACCCAGCAGCCCCCCCGCCGCCTCCAT
CGCCTGCTCTCGCTTTTCCACAACTCGTCCAACAAGCAACACCCCGCCTGCCATGCCGCCCATACCCTCGCCCAG
ATTCGCGCTCTCGGCCTCATGGGAGTCTACCTGACAGACCAGCTCCACGGTGGCTATACGAGATGGCCTGCCGCA
TGGATGCAGCTTGCCGATGCCGTGGCGCAATGGCAACTGTGA
Transcript >OphauB2|998
ATGGCGCGCGACATGGTGGCCCCCTTCATCCTCGTGCCGCTCTACATGTACCCGCTGGAGCAGGCATGGGAGCCA
CTGTTCCAGGCGGCTCGCGCCCACCGTGAGGTGCGCTTCGTGGCGGTGGTGAATCCGGCCAGCGGACCCGGGGCT
GAGGCGCTTCCGGACCAGAGCTACATTGCGGCTCTACGGCGCTTGGCCGACGAGCCCAACATTGAGGCGGTTGGC
TATGTCTACTGCAGCTATGGCGCTCGCCAGCCTGCCGCCGTCTGTGCCGACATGGAGGCCTACTGCGGCTGGCGC
CTCGACGGGCAGCCCGTGATTGGGGGCGTCTTTTTTGACGAGGCGCCTGCTGGCCACGACAAGGTGGACTGGATG
CATCACCTGGCCCGTCACGCACACCAGACGTGGCGCGCCCAGCATGACGCCCAGCATGATGCCCAGCATGATGCC
CAGCATGACGCCCACGACGCCTGCCCGCCTGTGGGGGAGACGCCAGCCCAAGACTCCAAGGCCCTCGACTCCAAG
GCCCTCGACTCCAAGGCCCTCGTCATCCTCAACCCTGGCGTTGCCGTGCCTCTGGCCTACTTTGCCCACTGCCAC
CACGTCGTCGTCTTTGAGGGCTCCGAGGCTGAGTGGCAGCGCCGCTGCATCGACCAGCCTGGCCTTGACCCCATT
CTCCGCGACCACGACGCTCTCTCCAAGGCCGTCGCCATTATCCACTCCACCCAGCAGCCCCCCCGCCGCCTCCAT
CGCCTGCTCTCGCTTTTCCACAACTCGTCCAACAAGCAACACCCCGCCTGCCATGCCGCCCATACCCTCGCCCAG
ATTCGCGCTCTCGGCCTCATGGGAGTCTACCTGACAGACCAGCTCCACGGTGGCTATACGAGATGGCCTGCCGCA
TGGATGCAGCTTGCCGATGCCGTGGCGCAATGGCAACTGTGA
Gene >OphauB2|998
ATGGCGCGCGACATGGTGGCCCCCTTCATCCTCGTGCCGCTCTACATGTACCCGCTGGAGCAGGCATGGGAGCCA
CTGTTCCAGGCGGCTCGCGCCCACCGTGAGGTGCGCTTCGTGGCGGTGGTGAATCCGGCCAGCGGACCCGGGGCT
GAGGCGCTTCCGGACCAGAGCTACATTGCGGCTCTACGGCGCTTGGCCGACGAGCCCAACATTGAGGCGGTTGGC
TATGTCTACTGCAGCTATGGCGCTCGCCAGCCTGCCGCCGTCTGTGCCGACATGGAGGCCTACTGCGGCTGGCGC
CTCGACGGGCAGCCCGTGATTGGGGGCGTCTTTTTTGACGAGGCGCCTGCTGGCCACGACAAGGTGGACTGGATG
CATCACCTGGCCCGTCACGCACACCAGACGTGGCGCGCCCAGCATGACGCCCAGCATGATGCCCAGCATGATGCC
CAGCATGACGCCCACGACGCCTGCCCGCCTGTGGGGGAGACGCCAGCCCAAGACTCCAAGGCCCTCGACTCCAAG
GCCCTCGACTCCAAGGCCCTCGTCATCCTCAACCCTGGCGTTGCCGTGCCTCTGGCCTACTTTGCCCACTGCCAC
CACGTCGTCGTCTTTGAGGGCTCCGAGGCTGAGTGGCAGCGCCGCTGCATCGACCAGCCTGGCCTTGACCCCATT
CTCCGCGACCACGACGCTCTCTCCAAGGCCGTCGCCATTATCCACTCCACCCAGCAGCCCCCCCGCCGCCTCCAT
CGCCTGCTCTCGCTTTTCCACAACTCGTCCAACAAGCAACACCCCGCCTGCCATGCCGCCCATACCCTCGCCCAG
ATTCGCGCTCTCGGCCTCATGGGAGTCTACCTGACAGACCAGCTCCACGGTGGCTATACGAGATGGCCTGCCGCA
TGGATGCAGCTTGCCGATGCCGTGGCGCAATGGCAACTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail