Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|996
Gene name
LocationContig_121:59745..60944
Strand+
Gene length (bp)1199
Transcript length (bp)1056
Coding sequence length (bp)1056
Protein length (aa) 352

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00561 Abhydrolase_1 alpha/beta hydrolase fold 4.3E-09 56 296

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O27848|METX_METTH Homoserine O-acetyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metX PE=3 SV=1 7 318 4.0E-16
sp|B2IY96|METX_NOSP7 Homoserine O-acetyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=metX PE=3 SV=1 14 296 1.0E-14
sp|Q98G09|METX_RHILO Homoserine O-acetyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metX PE=3 SV=1 14 168 3.0E-14
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 12 296 3.0E-14
sp|Q20YI1|METX_RHOPB Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=metX PE=3 SV=1 14 168 4.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O27848|METX_METTH Homoserine O-acetyltransferase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=metX PE=3 SV=1 7 318 4.0E-16
sp|B2IY96|METX_NOSP7 Homoserine O-acetyltransferase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=metX PE=3 SV=1 14 296 1.0E-14
sp|Q98G09|METX_RHILO Homoserine O-acetyltransferase OS=Rhizobium loti (strain MAFF303099) GN=metX PE=3 SV=1 14 168 3.0E-14
sp|Q3M5Q6|METX_ANAVT Homoserine O-acetyltransferase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=metX PE=3 SV=1 12 296 3.0E-14
sp|Q20YI1|METX_RHOPB Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain BisB18) GN=metX PE=3 SV=1 14 168 4.0E-14
sp|B3QZ51|METX_CHLT3 Homoserine O-acetyltransferase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=metX PE=3 SV=1 14 302 1.0E-13
sp|Q3A7G2|METX_PELCD Homoserine O-acetyltransferase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=metX PE=3 SV=2 2 152 1.0E-13
sp|Q2RP84|METX_RHORT Homoserine O-acetyltransferase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=metX PE=3 SV=1 24 349 1.0E-13
sp|Q67NS3|METX_SYMTH Homoserine O-acetyltransferase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=metX PE=3 SV=1 55 320 3.0E-13
sp|Q74AC8|METX_GEOSL Homoserine O-acetyltransferase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=metX PE=3 SV=1 11 150 3.0E-13
sp|A1AUS2|METX_PELPD Homoserine O-acetyltransferase OS=Pelobacter propionicus (strain DSM 2379) GN=metX PE=3 SV=1 14 150 5.0E-13
sp|A2SLU8|METX_METPP Homoserine O-acetyltransferase OS=Methylibium petroleiphilum (strain PM1) GN=metX PE=3 SV=1 13 306 1.0E-12
sp|B9M4M5|METX_GEODF Homoserine O-acetyltransferase OS=Geobacter daltonii (strain DSM 22248 / JCM 15807 / FRC-32) GN=metX PE=3 SV=1 11 150 1.0E-12
sp|Q0BVW2|METX_GRABC Homoserine O-acetyltransferase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=metX PE=3 SV=1 13 304 1.0E-12
sp|B1XW69|METX_LEPCP Homoserine O-acetyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=metX PE=3 SV=1 13 306 1.0E-12
sp|Q3ARA7|METX_CHLCH Homoserine O-acetyltransferase OS=Chlorobium chlorochromatii (strain CaD3) GN=metX PE=3 SV=1 15 302 2.0E-12
sp|Q9AAS1|METX_CAUCR Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=metX PE=3 SV=1 14 168 4.0E-12
sp|B8GZZ0|METX_CAUCN Homoserine O-acetyltransferase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=metX PE=3 SV=1 14 168 4.0E-12
sp|Q47L17|METX_THEFY Homoserine O-acetyltransferase OS=Thermobifida fusca (strain YX) GN=metX PE=3 SV=1 13 150 6.0E-12
sp|Q6NIZ3|METX_CORDI Homoserine O-acetyltransferase OS=Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis) GN=metX PE=3 SV=1 9 341 6.0E-12
sp|A5GC94|METX_GEOUR Homoserine O-acetyltransferase OS=Geobacter uraniireducens (strain Rf4) GN=metX PE=3 SV=1 14 150 7.0E-12
sp|Q39RX3|METX_GEOMG Homoserine O-acetyltransferase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=metX PE=3 SV=1 14 150 9.0E-12
sp|Q2S8M0|METX_HAHCH Homoserine O-acetyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=metX PE=3 SV=1 14 315 1.0E-11
sp|Q2IS70|METX_RHOP2 Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain HaA2) GN=metX PE=3 SV=1 14 168 1.0E-11
sp|O68640|METX_CORGL Homoserine O-acetyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=metX PE=1 SV=2 9 304 1.0E-11
sp|B5EAS1|METX_GEOBB Homoserine O-acetyltransferase OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622) GN=metX PE=3 SV=1 14 150 2.0E-11
sp|Q5NR05|METX_ZYMMO Homoserine O-acetyltransferase OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=metX PE=3 SV=1 10 168 2.0E-11
sp|Q2RIW8|METX_MOOTA Homoserine O-acetyltransferase OS=Moorella thermoacetica (strain ATCC 39073) GN=metX PE=3 SV=1 14 168 3.0E-11
sp|Q3SV39|METX_NITWN Homoserine O-acetyltransferase OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=metX PE=3 SV=1 13 168 3.0E-11
sp|Q0ABU4|METX_ALKEH Homoserine O-acetyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=metX PE=3 SV=1 13 315 5.0E-11
sp|Q6N1G8|METX_RHOPA Homoserine O-acetyltransferase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=metX PE=3 SV=1 13 168 8.0E-11
sp|Q3AAW2|METX_CARHZ Homoserine O-acetyltransferase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=metX PE=3 SV=1 1 309 9.0E-11
sp|Q6ANV2|METX_DESPS Homoserine O-acetyltransferase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=metX PE=3 SV=2 14 167 1.0E-10
sp|Q89UL7|METX_BRADU Homoserine O-acetyltransferase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=metX PE=3 SV=1 13 315 1.0E-10
sp|Q1QQD3|METX_NITHX Homoserine O-acetyltransferase OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=metX PE=3 SV=1 13 168 2.0E-10
sp|Q4JTI5|METX_CORJK Homoserine O-acetyltransferase OS=Corynebacterium jeikeium (strain K411) GN=metX PE=3 SV=1 2 303 2.0E-10
sp|B5ELV1|METX_ACIF5 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=metX PE=3 SV=1 14 302 3.0E-10
sp|B7J437|METX_ACIF2 Homoserine O-acetyltransferase OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=metX PE=3 SV=1 14 302 3.0E-10
sp|Q5P4R1|METX_AROAE Homoserine O-acetyltransferase OS=Aromatoleum aromaticum (strain EbN1) GN=metX PE=3 SV=1 13 168 4.0E-10
sp|A0LCI7|METX_MAGMM Homoserine O-acetyltransferase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=metX PE=3 SV=1 55 320 4.0E-10
sp|Q04RK8|METX_LEPBJ Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=metX PE=3 SV=1 2 168 5.0E-10
sp|Q6ADB9|METX_LEIXX Homoserine O-acetyltransferase OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=metX PE=3 SV=1 8 296 5.0E-10
sp|Q4FP51|METX_PELUB Homoserine O-acetyltransferase OS=Pelagibacter ubique (strain HTCC1062) GN=metX PE=3 SV=1 14 296 6.0E-10
sp|Q052B3|METX_LEPBL Homoserine O-acetyltransferase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=metX PE=3 SV=1 2 168 6.0E-10
sp|Q6FEQ3|METX_ACIAD Homoserine O-acetyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=metX PE=3 SV=1 55 302 6.0E-10
sp|Q3B5A5|METX_CHLL7 Homoserine O-acetyltransferase OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=metX PE=3 SV=1 15 320 1.0E-09
sp|Q8F4I0|METX_LEPIN Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=metX PE=1 SV=1 2 168 2.0E-09
sp|Q72R95|METX_LEPIC Homoserine O-acetyltransferase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=metX PE=3 SV=1 2 168 2.0E-09
sp|Q8FRT0|METX_COREF Homoserine O-acetyltransferase OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=metX PE=3 SV=3 6 137 2.0E-09
sp|Q8KES7|METX_CHLTE Homoserine O-acetyltransferase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=metX PE=3 SV=1 14 296 3.0E-09
sp|Q06736|MET2_SACPS Homoserine O-acetyltransferase OS=Saccharomyces pastorianus GN=MET2 PE=3 SV=1 14 150 3.0E-09
sp|A4G1K0|METX_HERAR Homoserine O-acetyltransferase OS=Herminiimonas arsenicoxydans GN=metX PE=3 SV=2 13 306 4.0E-09
sp|Q9JZQ5|METX_NEIMB Homoserine O-acetyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=metX PE=3 SV=1 14 320 4.0E-09
sp|B3QM89|METX_CHLP8 Homoserine O-acetyltransferase OS=Chlorobaculum parvum (strain NCIB 8327) GN=metX PE=3 SV=1 2 296 7.0E-09
sp|P08465|MET2_YEAST Homoserine O-acetyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MET2 PE=1 SV=2 14 150 7.0E-09
sp|P94891|METX_LEPME Homoserine O-acetyltransferase OS=Leptospira meyeri GN=metX PE=3 SV=1 14 168 8.0E-09
sp|B0SQZ8|METX_LEPBP Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=metX PE=3 SV=1 14 302 1.0E-08
sp|B0SHJ0|METX_LEPBA Homoserine O-acetyltransferase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=metX PE=3 SV=1 14 302 1.0E-08
sp|Q7NZY3|METX_CHRVO Homoserine O-acetyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=metX PE=3 SV=1 13 341 1.0E-08
sp|A5FVN0|METX_ACICJ Homoserine O-acetyltransferase OS=Acidiphilium cryptum (strain JF-5) GN=metX PE=3 SV=1 14 304 1.0E-08
sp|B3E278|METX_GEOLS Homoserine O-acetyltransferase OS=Geobacter lovleyi (strain ATCC BAA-1151 / DSM 17278 / SZ) GN=metX PE=3 SV=1 14 150 1.0E-08
sp|B2JJW9|METX_BURP8 Homoserine O-acetyltransferase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=metX PE=3 SV=1 14 302 1.0E-08
sp|A1WVL3|METX_HALHL Homoserine O-acetyltransferase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=metX PE=3 SV=1 13 168 2.0E-08
sp|A1KCN1|METX_AZOSB Homoserine O-acetyltransferase OS=Azoarcus sp. (strain BH72) GN=metX PE=3 SV=1 13 167 3.0E-08
sp|Q31EJ2|METX_THICR Homoserine O-acetyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=metX PE=3 SV=1 13 167 4.0E-08
sp|A6SUC4|METX_JANMA Homoserine O-acetyltransferase OS=Janthinobacterium sp. (strain Marseille) GN=metX PE=3 SV=1 13 315 4.0E-08
sp|P39058|CEFG_ACRCH Acetyl-CoA--deacetylcephalosporin C acetyltransferase OS=Acremonium chrysogenum GN=CEFG PE=1 SV=1 14 150 4.0E-08
sp|Q3JXB2|METX_BURP1 Homoserine O-acetyltransferase OS=Burkholderia pseudomallei (strain 1710b) GN=metX PE=3 SV=1 14 315 6.0E-08
sp|B0VL51|METX_ACIBS Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain SDF) GN=metX PE=3 SV=1 55 302 7.0E-08
sp|A3M1Y2|METX_ACIBT Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=metX PE=3 SV=2 55 302 7.0E-08
sp|B2I3B6|METX_ACIBC Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=metX PE=3 SV=1 55 302 7.0E-08
sp|Q5F858|METX_NEIG1 Homoserine O-acetyltransferase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=metX PE=3 SV=1 14 320 8.0E-08
sp|B0V4S0|METX_ACIBY Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AYE) GN=metX PE=3 SV=1 55 302 8.0E-08
sp|B7I4X4|METX_ACIB5 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=metX PE=3 SV=1 55 302 8.0E-08
sp|B7H098|METX_ACIB3 Homoserine O-acetyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=metX PE=3 SV=1 55 302 8.0E-08
sp|Q5FUF4|METX_GLUOX Homoserine O-acetyltransferase OS=Gluconobacter oxydans (strain 621H) GN=metX PE=3 SV=1 14 168 2.0E-07
sp|A4JIS1|METX_BURVG Homoserine O-acetyltransferase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|B1YPU9|METX_BURA4 Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain MC40-6) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|A0KBH0|METX_BURCH Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain HI2424) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|B1K0G8|METX_BURCC Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain MC0-3) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|Q1BSM1|METX_BURCA Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain AU 1054) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|A6W3E8|METX_MARMS Homoserine O-acetyltransferase OS=Marinomonas sp. (strain MWYL1) GN=metX PE=3 SV=1 14 315 3.0E-07
sp|Q39BX2|METX_BURL3 Homoserine O-acetyltransferase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=metX PE=3 SV=1 14 315 4.0E-07
sp|A1SMU5|METX_NOCSJ Homoserine O-acetyltransferase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=metX PE=3 SV=1 14 168 4.0E-07
sp|Q0BAW3|METX_BURCM Homoserine O-acetyltransferase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=metX PE=3 SV=1 14 315 5.0E-07
sp|B2HDS6|METX_MYCMM Homoserine O-acetyltransferase OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=metX PE=3 SV=1 3 216 6.0E-07
sp|B4E7Y5|METX_BURCJ Homoserine O-acetyltransferase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=metX PE=3 SV=1 14 315 6.0E-07
sp|A0PNQ1|METX_MYCUA Homoserine O-acetyltransferase OS=Mycobacterium ulcerans (strain Agy99) GN=metX PE=3 SV=1 3 169 6.0E-07
sp|A9AC42|METX_BURM1 Homoserine O-acetyltransferase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=metX PE=3 SV=1 14 315 6.0E-07
sp|P45131|METX_HAEIN Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=metX PE=1 SV=3 14 320 6.0E-07
sp|Q3IUE8|METX_NATPD Homoserine O-acetyltransferase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=metX PE=3 SV=1 1 137 6.0E-07
sp|Q65U29|METX_MANSM Homoserine O-acetyltransferase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=metX PE=3 SV=2 17 148 7.0E-07
sp|Q4QJY8|METX_HAEI8 Homoserine O-acetyltransferase OS=Haemophilus influenzae (strain 86-028NP) GN=metX PE=3 SV=1 17 320 8.0E-07
sp|Q4K4D3|METX_PSEF5 Homoserine O-acetyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=metX PE=3 SV=1 14 306 9.0E-07
sp|Q2YCJ2|METX_NITMU Homoserine O-acetyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=metX PE=3 SV=1 14 167 1.0E-06
sp|B2U7Y8|METX_RALPJ Homoserine O-acetyltransferase OS=Ralstonia pickettii (strain 12J) GN=metX PE=3 SV=1 54 302 1.0E-06
sp|Q1IGC6|METX_PSEE4 Homoserine O-acetyltransferase OS=Pseudomonas entomophila (strain L48) GN=metX PE=3 SV=1 55 167 1.0E-06
sp|A5WAD0|METX_PSEP1 Homoserine O-acetyltransferase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=metX PE=3 SV=1 55 320 1.0E-06
sp|B2FMC1|METX_STRMK Homoserine O-acetyltransferase OS=Stenotrophomonas maltophilia (strain K279a) GN=metX PE=3 SV=1 12 151 2.0E-06
sp|Q8Y3F3|METX_RALSO Homoserine O-acetyltransferase OS=Ralstonia solanacearum (strain GMI1000) GN=metX PE=3 SV=1 13 302 2.0E-06
sp|Q47JU2|METX_DECAR Homoserine O-acetyltransferase OS=Dechloromonas aromatica (strain RCB) GN=metX PE=3 SV=1 14 302 2.0E-06
sp|B3PFK3|METX_CELJU Homoserine O-acetyltransferase OS=Cellvibrio japonicus (strain Ueda107) GN=metX PE=3 SV=1 55 302 4.0E-06
sp|B1J2H5|METX_PSEPW Homoserine O-acetyltransferase OS=Pseudomonas putida (strain W619) GN=metX PE=3 SV=1 55 167 4.0E-06
sp|Q88CT3|METX_PSEPK Homoserine O-acetyltransferase OS=Pseudomonas putida (strain KT2440) GN=metX PE=3 SV=1 55 320 5.0E-06
sp|P12917|MET2_ASCIM Homoserine O-acetyltransferase OS=Ascobolus immersus GN=MET2 PE=3 SV=1 14 150 5.0E-06
sp|Q4FUR4|METX_PSYA2 Homoserine O-acetyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=metX PE=3 SV=1 14 168 6.0E-06
sp|A4VRJ2|METX_PSEU5 Homoserine O-acetyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=metX PE=3 SV=1 55 168 9.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup803
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7761
Ophiocordyceps australis map64 (Brazil) OphauB2|996 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|06001
Ophiocordyceps camponoti-rufipedis Ophun1|960
Ophiocordyceps kimflemingae Ophio5|8627
Ophiocordyceps kimflemingae Ophio5|8628
Ophiocordyceps subramaniannii Hirsu2|3553

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|996
MTDYKTFNLGDWPLESGASLPNAFIAYKTYGDKSLPAIIYPTWFSGSIADNEWLISPAQTLSPHRFFIIVPALFG
NGQSTSPSNSPHRPFPSITLRDNVRAQHDLVTRGLGVENALCVLGWSMGAGQTYEWIVQFPDFCKLAVPFCGSAR
TALHNQVFLEGVKAALLAAKGVASNGSGANEQTDEWTREQKQVGLKAMARVYAGWGFSQTFYRQKLYQTELGYKD
LEHFMVEYWEAWGLSKDPQNILVMLNTWQRADCSKNETFKGDFERAMMSIKAKTLVLPGQTDLYFPPEDSEYEVQ
CMGKDRSKCVAFPSVWGHWAGGPGLSKTDLKWLDGILKAFLLDGQLVHGRI*
Coding >OphauB2|996
ATGACCGACTACAAAACATTTAATCTCGGCGACTGGCCCCTCGAATCTGGGGCCTCCCTGCCCAACGCCTTCATC
GCATACAAAACATATGGCGACAAGTCCCTCCCCGCAATCATCTATCCAACCTGGTTCAGCGGCTCCATTGCCGAC
AACGAATGGCTCATCAGCCCAGCCCAGACCCTCTCGCCTCACCGCTTCTTCATCATCGTCCCCGCCCTCTTTGGC
AACGGCCAATCAACCAGCCCGTCAAACTCGCCGCACCGCCCTTTTCCATCCATCACCTTGCGCGACAATGTCCGC
GCACAGCATGACTTGGTCACGCGCGGGCTCGGCGTCGAAAACGCCCTCTGCGTCTTGGGATGGAGCATGGGCGCC
GGCCAGACATATGAGTGGATAGTCCAGTTTCCAGACTTTTGTAAACTCGCGGTCCCCTTTTGCGGCAGTGCGCGC
ACGGCGCTGCATAACCAGGTGTTTCTCGAGGGAGTAAAGGCGGCGCTGCTGGCAGCAAAGGGTGTCGCCTCAAAT
GGAAGTGGAGCTAATGAGCAGACGGATGAGTGGACTCGGGAGCAAAAACAAGTTGGGCTCAAGGCCATGGCTCGT
GTCTATGCAGGCTGGGGATTCAGCCAGACCTTTTACCGGCAGAAGCTGTACCAGACGGAGCTTGGATATAAAGAT
TTGGAGCACTTCATGGTTGAGTATTGGGAGGCGTGGGGCCTCTCCAAAGATCCTCAAAATATCCTCGTCATGTTA
AACACATGGCAACGCGCCGACTGCTCAAAGAATGAAACCTTCAAGGGCGACTTTGAGCGCGCAATGATGAGCATC
AAGGCCAAGACGCTGGTGCTTCCCGGACAGACGGATCTGTACTTTCCGCCCGAAGACAGCGAATACGAGGTGCAA
TGCATGGGCAAAGACAGAAGCAAGTGTGTTGCCTTTCCCTCTGTTTGGGGGCACTGGGCTGGAGGTCCTGGGCTG
AGCAAAACCGACTTGAAGTGGCTTGACGGGATTCTCAAGGCGTTTTTACTCGACGGGCAGTTGGTACATGGGCGT
ATCTGA
Transcript >OphauB2|996
ATGACCGACTACAAAACATTTAATCTCGGCGACTGGCCCCTCGAATCTGGGGCCTCCCTGCCCAACGCCTTCATC
GCATACAAAACATATGGCGACAAGTCCCTCCCCGCAATCATCTATCCAACCTGGTTCAGCGGCTCCATTGCCGAC
AACGAATGGCTCATCAGCCCAGCCCAGACCCTCTCGCCTCACCGCTTCTTCATCATCGTCCCCGCCCTCTTTGGC
AACGGCCAATCAACCAGCCCGTCAAACTCGCCGCACCGCCCTTTTCCATCCATCACCTTGCGCGACAATGTCCGC
GCACAGCATGACTTGGTCACGCGCGGGCTCGGCGTCGAAAACGCCCTCTGCGTCTTGGGATGGAGCATGGGCGCC
GGCCAGACATATGAGTGGATAGTCCAGTTTCCAGACTTTTGTAAACTCGCGGTCCCCTTTTGCGGCAGTGCGCGC
ACGGCGCTGCATAACCAGGTGTTTCTCGAGGGAGTAAAGGCGGCGCTGCTGGCAGCAAAGGGTGTCGCCTCAAAT
GGAAGTGGAGCTAATGAGCAGACGGATGAGTGGACTCGGGAGCAAAAACAAGTTGGGCTCAAGGCCATGGCTCGT
GTCTATGCAGGCTGGGGATTCAGCCAGACCTTTTACCGGCAGAAGCTGTACCAGACGGAGCTTGGATATAAAGAT
TTGGAGCACTTCATGGTTGAGTATTGGGAGGCGTGGGGCCTCTCCAAAGATCCTCAAAATATCCTCGTCATGTTA
AACACATGGCAACGCGCCGACTGCTCAAAGAATGAAACCTTCAAGGGCGACTTTGAGCGCGCAATGATGAGCATC
AAGGCCAAGACGCTGGTGCTTCCCGGACAGACGGATCTGTACTTTCCGCCCGAAGACAGCGAATACGAGGTGCAA
TGCATGGGCAAAGACAGAAGCAAGTGTGTTGCCTTTCCCTCTGTTTGGGGGCACTGGGCTGGAGGTCCTGGGCTG
AGCAAAACCGACTTGAAGTGGCTTGACGGGATTCTCAAGGCGTTTTTACTCGACGGGCAGTTGGTACATGGGCGT
ATCTGA
Gene >OphauB2|996
ATGACCGACTACAAAACATTTAATCTCGGCGACTGGCCCCTCGAATCTGGGGCCTCCCTGCCCAACGCCTTCATC
GCATACAAAACATATGGCGACAAGTCCCTCCCCGCAATCATCTATCCAACCTGGTTCAGCGGCTCCATTGCCGAC
AACGAATGGCTCATCAGCCCAGCCCAGACCCTCTCGCCTCACCGCTTCTTCATCATCGTCCCCGCCCTCTTTGGC
AACGGCCAATCAACCAGCCCGTCAAACTCGCCGCACCGCCCTTTTCCATCCATCACCTTGCGCGACAATGTCCGC
GCACAGCATGACTTGGTCACGCGCGGGCTCGGCGTCGAAAACGCCCTCTGCGTCTTGGGATGGAGCATGGGCGCC
GGCCAGACATATGAGTGGATAGTCCAGTTTCCAGACTTTTGTAAACTCGCGGTCCCCTTTTGCGGCAGTGCGCGC
ACGGCGCTGCATAACCAGGTGTTTCTCGAGGGAGTAAAGGCGGCGCTGCTGGCAGCAAAGGGTGTCGCCTCAAAT
GGAAGTGGAGCTAATGAGCAGACGGATGAGTGGACTCGGGAGCAAAAACAAGTTGGGCTCAAGGCCATGGCTCGT
GTCTATGCAGGCTGGGGATTCAGCCAGACCTTTTACCGGCAGAAGCTGTACCAGACGGAGCTTGGATATAAAGAT
TTGGAGCACTTCATGGTTGAGTATTGGGAGGCGTGGGGCCTCTCCAAAGGTGAGTCTGTTTCTCGGCCCCTTTTC
AGCCTTAGTTGTCCCGCCTCTGTTGCCTCTAAAAGTTGGGGCTGCTAGATCCTCAAAATATCCTCGTCATGTTAA
ACACATGGCAACGCGCCGACTGCTCAAAGAATGAAACCTTCAAGGGCGACTTTGAGCGCGCAATGATGAGCATCA
AGGCCAAGACGCTGGTGCTTCCCGGACAGACGGATCTGTACTTTCCGCCCGAAGACAGCGAATACGAGGTGCAAT
GCATGGGCAAAGACAGAAGCAAGTGTGTTGCCTTTCCCTCTGTTTGGGGGCACTGGTAGGTTTGGCATTTCCCCC
AAGAATATTTTCTAATAATGAAGCCTGCTGATTGCTGTGAAATTTTCAGGGCTGGAGGTCCTGGGCTGAGCAAAA
CCGACTTGAAGTGGCTTGACGGGATTCTCAAGGCGTTTTTACTCGACGGGCAGTTGGTACATGGGCGTATCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail