Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|989
Gene name
LocationContig_121:35803..37044
Strand-
Gene length (bp)1241
Transcript length (bp)1161
Coding sequence length (bp)1161
Protein length (aa) 387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10445 DUF2456 Protein of unknown function (DUF2456) 2.6E-18 157 227

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O74505|YJD2_SCHPO Uncharacterized protein C594.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC594.02c PE=1 SV=1 44 225 2.0E-30
sp|P38740|YHC6_YEAST Uncharacterized protein YHL026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL026C PE=1 SV=2 43 114 9.0E-10
sp|P38740|YHC6_YEAST Uncharacterized protein YHL026C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHL026C PE=1 SV=2 160 223 1.0E-07

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.5

Transmembrane Domains

Domain # Start End Length
1 42 64 22
2 84 106 22
3 164 186 22
4 207 229 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|989
MFWRKKDAAAHEADAQEQGEQAEHHGEHEQLEPSTRLTGHQFFYLFVLDGIGGMILPAAINFAIAYGMYKSQNIE
RHPIRLFQLPNTLAGDAAVTIFVQTVITWMIEALLVSHDLAAGGVRPIGFVPSPRNAWVRRLLLLPADGTAKVAG
ARPFSSFAAFVGQVVRSLLLGAASFLLLWPISIGILTAVGTRRGGDWEFGRKWAPQVFKAILAGVLGLLTTPLMA
AFWLVRAAWESRDEGGGSAMAQPPGQSVVAPRLQSAAGAELPAGADSAAGPEPPVGSESAESAAEAESAAESAAE
PETPAESATIEHATNPPTEPATVAPPSRPIREQTIEEASEASIDAAMEQTREPALEAARHGDAPSCAPPSPKPLA
AAAETERQLEP*
Coding >OphauB2|989
ATGTTTTGGCGCAAAAAGGACGCGGCGGCGCACGAGGCAGATGCGCAGGAGCAGGGCGAGCAAGCTGAGCATCAT
GGCGAGCATGAGCAGCTGGAGCCGAGTACGCGCCTCACGGGACATCAGTTTTTTTACCTCTTTGTGCTTGACGGG
ATTGGCGGCATGATTCTCCCAGCAGCGATAAATTTTGCCATTGCCTATGGCATGTATAAGTCGCAGAATATTGAG
CGTCATCCGATTCGACTCTTTCAGCTTCCCAACACGCTGGCAGGAGACGCGGCGGTGACGATATTTGTGCAGACA
GTCATTACATGGATGATTGAAGCGCTGCTGGTGAGCCACGACTTGGCGGCCGGGGGGGTGCGACCGATTGGATTT
GTGCCGAGTCCACGAAACGCGTGGGTGCGTCGCTTGCTGCTTTTGCCAGCCGATGGGACGGCCAAGGTGGCTGGT
GCGCGGCCGTTTAGCTCGTTTGCGGCCTTTGTGGGTCAAGTGGTGAGGAGTTTGCTGCTGGGGGCGGCGAGCTTC
TTGCTGCTGTGGCCGATTAGCATTGGGATACTGACGGCGGTGGGGACGAGGAGGGGAGGGGACTGGGAGTTTGGG
AGGAAGTGGGCGCCGCAGGTGTTCAAGGCGATATTGGCGGGGGTGTTGGGCTTGTTGACGACGCCCTTGATGGCG
GCGTTTTGGCTGGTGAGGGCGGCGTGGGAGAGTCGAGACGAGGGGGGAGGGTCGGCCATGGCGCAGCCGCCGGGG
CAGTCTGTCGTGGCGCCTCGTTTGCAGTCGGCAGCAGGTGCAGAATTGCCAGCAGGTGCAGATTCGGCAGCAGGT
CCAGAACCGCCAGTAGGTTCAGAATCAGCAGAGTCAGCAGCAGAGGCAGAATCAGCAGCAGAATCAGCAGCAGAA
CCAGAAACTCCAGCAGAATCAGCAACAATCGAGCACGCGACGAATCCACCGACAGAGCCAGCTACAGTGGCACCC
CCCTCAAGACCCATTCGAGAACAAACGATTGAAGAGGCGAGCGAGGCTTCAATAGATGCCGCAATGGAGCAGACG
CGGGAGCCAGCGCTCGAGGCTGCCAGACATGGCGACGCGCCATCATGTGCACCGCCGTCGCCCAAGCCATTAGCA
GCAGCAGCCGAGACAGAGAGGCAGCTTGAACCATGA
Transcript >OphauB2|989
ATGTTTTGGCGCAAAAAGGACGCGGCGGCGCACGAGGCAGATGCGCAGGAGCAGGGCGAGCAAGCTGAGCATCAT
GGCGAGCATGAGCAGCTGGAGCCGAGTACGCGCCTCACGGGACATCAGTTTTTTTACCTCTTTGTGCTTGACGGG
ATTGGCGGCATGATTCTCCCAGCAGCGATAAATTTTGCCATTGCCTATGGCATGTATAAGTCGCAGAATATTGAG
CGTCATCCGATTCGACTCTTTCAGCTTCCCAACACGCTGGCAGGAGACGCGGCGGTGACGATATTTGTGCAGACA
GTCATTACATGGATGATTGAAGCGCTGCTGGTGAGCCACGACTTGGCGGCCGGGGGGGTGCGACCGATTGGATTT
GTGCCGAGTCCACGAAACGCGTGGGTGCGTCGCTTGCTGCTTTTGCCAGCCGATGGGACGGCCAAGGTGGCTGGT
GCGCGGCCGTTTAGCTCGTTTGCGGCCTTTGTGGGTCAAGTGGTGAGGAGTTTGCTGCTGGGGGCGGCGAGCTTC
TTGCTGCTGTGGCCGATTAGCATTGGGATACTGACGGCGGTGGGGACGAGGAGGGGAGGGGACTGGGAGTTTGGG
AGGAAGTGGGCGCCGCAGGTGTTCAAGGCGATATTGGCGGGGGTGTTGGGCTTGTTGACGACGCCCTTGATGGCG
GCGTTTTGGCTGGTGAGGGCGGCGTGGGAGAGTCGAGACGAGGGGGGAGGGTCGGCCATGGCGCAGCCGCCGGGG
CAGTCTGTCGTGGCGCCTCGTTTGCAGTCGGCAGCAGGTGCAGAATTGCCAGCAGGTGCAGATTCGGCAGCAGGT
CCAGAACCGCCAGTAGGTTCAGAATCAGCAGAGTCAGCAGCAGAGGCAGAATCAGCAGCAGAATCAGCAGCAGAA
CCAGAAACTCCAGCAGAATCAGCAACAATCGAGCACGCGACGAATCCACCGACAGAGCCAGCTACAGTGGCACCC
CCCTCAAGACCCATTCGAGAACAAACGATTGAAGAGGCGAGCGAGGCTTCAATAGATGCCGCAATGGAGCAGACG
CGGGAGCCAGCGCTCGAGGCTGCCAGACATGGCGACGCGCCATCATGTGCACCGCCGTCGCCCAAGCCATTAGCA
GCAGCAGCCGAGACAGAGAGGCAGCTTGAACCATGA
Gene >OphauB2|989
ATGTTTTGGCGCAAAAAGGACGCGGCGGCGCACGAGGCAGATGCGCAGGAGCAGGGCGAGCAAGCTGAGCATCAT
GGCGAGCATGAGCAGCTGGAGCCGAGTACGCGCCTCACGGGACATCAGTTTTTTTACCTCTTTGTGCTTGACGGG
ATTGGCGGCATGATTCTCCCAGCAGCGATAAATTTTGCCATTGCCTATGGTTTGTTCTTACTTGTTGGGGGGGGC
GGTGGAAGAAGAAGTGAGGCGCAAACAAGTGCTAATTTTGGGGGTGTGGAATAGGCATGTATAAGTCGCAGAATA
TTGAGCGTCATCCGATTCGACTCTTTCAGCTTCCCAACACGCTGGCAGGAGACGCGGCGGTGACGATATTTGTGC
AGACAGTCATTACATGGATGATTGAAGCGCTGCTGGTGAGCCACGACTTGGCGGCCGGGGGGGTGCGACCGATTG
GATTTGTGCCGAGTCCACGAAACGCGTGGGTGCGTCGCTTGCTGCTTTTGCCAGCCGATGGGACGGCCAAGGTGG
CTGGTGCGCGGCCGTTTAGCTCGTTTGCGGCCTTTGTGGGTCAAGTGGTGAGGAGTTTGCTGCTGGGGGCGGCGA
GCTTCTTGCTGCTGTGGCCGATTAGCATTGGGATACTGACGGCGGTGGGGACGAGGAGGGGAGGGGACTGGGAGT
TTGGGAGGAAGTGGGCGCCGCAGGTGTTCAAGGCGATATTGGCGGGGGTGTTGGGCTTGTTGACGACGCCCTTGA
TGGCGGCGTTTTGGCTGGTGAGGGCGGCGTGGGAGAGTCGAGACGAGGGGGGAGGGTCGGCCATGGCGCAGCCGC
CGGGGCAGTCTGTCGTGGCGCCTCGTTTGCAGTCGGCAGCAGGTGCAGAATTGCCAGCAGGTGCAGATTCGGCAG
CAGGTCCAGAACCGCCAGTAGGTTCAGAATCAGCAGAGTCAGCAGCAGAGGCAGAATCAGCAGCAGAATCAGCAG
CAGAACCAGAAACTCCAGCAGAATCAGCAACAATCGAGCACGCGACGAATCCACCGACAGAGCCAGCTACAGTGG
CACCCCCCTCAAGACCCATTCGAGAACAAACGATTGAAGAGGCGAGCGAGGCTTCAATAGATGCCGCAATGGAGC
AGACGCGGGAGCCAGCGCTCGAGGCTGCCAGACATGGCGACGCGCCATCATGTGCACCGCCGTCGCCCAAGCCAT
TAGCAGCAGCAGCCGAGACAGAGAGGCAGCTTGAACCATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail