Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|986
Gene name
LocationContig_121:22393..23377
Strand-
Gene length (bp)984
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05141 DIT1_PvcA Pyoverdine/dityrosine biosynthesis protein 8.7E-68 76 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P21623|DIT1_YEAST Spore wall maturation protein DIT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DIT1 PE=1 SV=2 86 281 7.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup899
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2529
Ophiocordyceps australis 1348a (Ghana) OphauG2|2557
Ophiocordyceps australis 1348a (Ghana) OphauG2|3148
Ophiocordyceps australis map64 (Brazil) OphauB2|1785
Ophiocordyceps australis map64 (Brazil) OphauB2|985
Ophiocordyceps australis map64 (Brazil) OphauB2|986 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|7329
Ophiocordyceps subramaniannii Hirsu2|5853

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|986
MPSALDTSPMEPLAGKPCHPAAHLALLSSSLPSKVDSDALHTASAILRVIDRYRLKKAPDAPAKADEGALKFLAV
IYSHVRAGDEVPMCLPAFPFKSPNTSLKVLGRLPDKAEELALAHLNGLCEAIADVYPPGAKLTIISDGLVYNDLL
GVPDYCVWQYGETLRSLAAAKGYTRIDFSRLQNLVPIELPDKLDEMTYVANACNFRRALLNTFGRPDWDWKTVSQ
NEDVCLTYRGYIKFLETDLLDVYPIRDDRTKSKYKRGIEYIAKQMLARGDVSFAFPAASSFF*
Coding >OphauB2|986
ATGCCCTCTGCCCTCGACACCTCTCCCATGGAGCCTCTGGCCGGCAAGCCATGCCACCCGGCCGCGCACCTCGCC
CTCCTCTCCTCCAGCCTGCCCAGCAAAGTCGACAGCGACGCACTGCACACCGCCTCGGCCATTCTGCGCGTCATT
GACCGCTATCGTCTCAAAAAGGCGCCCGACGCACCTGCCAAGGCAGACGAGGGCGCGCTCAAGTTTCTAGCCGTG
ATTTACAGCCATGTGCGCGCCGGCGACGAGGTGCCCATGTGTCTGCCTGCGTTTCCCTTTAAATCGCCCAATACG
TCGCTCAAGGTGCTGGGCCGTCTGCCAGACAAGGCCGAGGAGCTGGCGCTGGCGCATCTAAATGGGCTGTGTGAG
GCGATTGCAGATGTATATCCGCCGGGGGCAAAGTTGACTATTATTTCGGATGGACTTGTATACAATGATCTCCTC
GGCGTGCCCGACTACTGCGTCTGGCAATACGGCGAGACGCTGCGCAGCCTGGCCGCCGCCAAGGGCTACACGCGC
ATCGACTTTTCGCGCCTGCAAAACCTGGTGCCCATTGAGCTGCCCGACAAGCTCGACGAAATGACCTATGTCGCC
AACGCGTGCAACTTTCGCCGCGCGCTGCTCAATACGTTTGGGCGGCCAGACTGGGACTGGAAGACGGTGAGCCAA
AACGAGGATGTGTGTCTGACATATCGTGGCTACATCAAGTTTCTCGAGACGGATTTGCTCGACGTGTATCCCATT
CGCGACGATAGGACAAAGTCCAAGTATAAAAGGGGCATTGAGTATATTGCCAAGCAGATGCTTGCCCGAGGAGAC
GTGAGTTTTGCTTTCCCTGCCGCCTCCTCTTTTTTTTAA
Transcript >OphauB2|986
ATGCCCTCTGCCCTCGACACCTCTCCCATGGAGCCTCTGGCCGGCAAGCCATGCCACCCGGCCGCGCACCTCGCC
CTCCTCTCCTCCAGCCTGCCCAGCAAAGTCGACAGCGACGCACTGCACACCGCCTCGGCCATTCTGCGCGTCATT
GACCGCTATCGTCTCAAAAAGGCGCCCGACGCACCTGCCAAGGCAGACGAGGGCGCGCTCAAGTTTCTAGCCGTG
ATTTACAGCCATGTGCGCGCCGGCGACGAGGTGCCCATGTGTCTGCCTGCGTTTCCCTTTAAATCGCCCAATACG
TCGCTCAAGGTGCTGGGCCGTCTGCCAGACAAGGCCGAGGAGCTGGCGCTGGCGCATCTAAATGGGCTGTGTGAG
GCGATTGCAGATGTATATCCGCCGGGGGCAAAGTTGACTATTATTTCGGATGGACTTGTATACAATGATCTCCTC
GGCGTGCCCGACTACTGCGTCTGGCAATACGGCGAGACGCTGCGCAGCCTGGCCGCCGCCAAGGGCTACACGCGC
ATCGACTTTTCGCGCCTGCAAAACCTGGTGCCCATTGAGCTGCCCGACAAGCTCGACGAAATGACCTATGTCGCC
AACGCGTGCAACTTTCGCCGCGCGCTGCTCAATACGTTTGGGCGGCCAGACTGGGACTGGAAGACGGTGAGCCAA
AACGAGGATGTGTGTCTGACATATCGTGGCTACATCAAGTTTCTCGAGACGGATTTGCTCGACGTGTATCCCATT
CGCGACGATAGGACAAAGTCCAAGTATAAAAGGGGCATTGAGTATATTGCCAAGCAGATGCTTGCCCGAGGAGAC
GTGAGTTTTGCTTTCCCTGCCGCCTCCTCTTTTTTTTAA
Gene >OphauB2|986
ATGCCCTCTGCCCTCGACACCTCTCCCATGGAGCCTCTGGCCGGCAAGCCATGCCACCCGGCCGCGCACCTCGCC
CTCCTCTCCTCCAGCCTGCCCAGCAAAGTCGACAGCGACGCACTGCACACCGCCTCGGCCATTCTGCGCGTCATT
GACCGCTATCGTCTCAAAAAGGCGCCCGACGCACCTGCCAAGGCAGACGAGGGCGCGCTCAAGTTTCTAGCCGTG
ATTTACAGCCATGTGCGCGCCGGCGACGAGGTGCCCATGTGTCTGCCTGCGTTTCCCTTTAAATCGCCCAATACG
TCGCTCAAGGTGCTGGGCCGTCTGCCAGACAAGGCCGAGGAGCTGGCGCTGGCGCATCTAAATGGGCTGTGTGAG
GCGATTGCAGATGTATATCCGCCGGGGGCAAAGTTGACTATTATTTCGGATGGACTTGTATACAATGGTTGGTCT
TTTTCTTTTTTTTTTCCTTTTCCAACTTGCCAACTTTTCAAACAATCACAACACAAGTCTTCCTTACTTGAAAAA
AAAAAAAAAAGAAAAAACCACTCACACCCTCTTCTAGATCTCCTCGGCGTGCCCGACTACTGCGTCTGGCAATAC
GGCGAGACGCTGCGCAGCCTGGCCGCCGCCAAGGGCTACACGCGCATCGACTTTTCGCGCCTGCAAAACCTGGTG
CCCATTGAGCTGCCCGACAAGCTCGACGAAATGACCTATGTCGCCAACGCGTGCAACTTTCGCCGCGCGCTGCTC
AATACGTTTGGGCGGCCAGACTGGGACTGGAAGACGGTGAGCCAAAACGAGGATGTGTGTCTGACATATCGTGGC
TACATCAAGTTTCTCGAGACGGATTTGCTCGACGTGTATCCCATTCGCGACGATAGGACAAAGTCCAAGTATAAA
AGGGGCATTGAGTATATTGCCAAGCAGATGCTTGCCCGAGGAGACGTGAGTTTTGCTTTCCCTGCCGCCTCCTCT
TTTTTTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail