Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|984
Gene name
LocationContig_121:18435..20510
Strand-
Gene length (bp)2075
Transcript length (bp)1638
Coding sequence length (bp)1638
Protein length (aa) 546

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07522 DRMBL DNA repair metallo-beta-lactamase 1.5E-05 355 386

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XIX3|DCR1C_RAT Protein artemis OS=Rattus norvegicus GN=Dclre1c PE=1 SV=1 26 184 2.0E-16
sp|Q8K4J0|DCR1C_MOUSE Protein artemis OS=Mus musculus GN=Dclre1c PE=1 SV=2 7 184 8.0E-16
sp|Q5RGE5|DCR1C_DANRE Protein artemis OS=Danio rerio GN=dclre1c PE=2 SV=1 35 174 9.0E-16
sp|Q5R6Z9|DCR1C_PONAB Protein artemis OS=Pongo abelii GN=DCLRE1C PE=2 SV=1 26 184 3.0E-15
sp|Q8C7W7|DCR1B_MOUSE 5' exonuclease Apollo OS=Mus musculus GN=Dclre1b PE=1 SV=2 18 277 5.0E-15
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q5XIX3|DCR1C_RAT Protein artemis OS=Rattus norvegicus GN=Dclre1c PE=1 SV=1 26 184 2.0E-16
sp|Q8K4J0|DCR1C_MOUSE Protein artemis OS=Mus musculus GN=Dclre1c PE=1 SV=2 7 184 8.0E-16
sp|Q5RGE5|DCR1C_DANRE Protein artemis OS=Danio rerio GN=dclre1c PE=2 SV=1 35 174 9.0E-16
sp|Q5R6Z9|DCR1C_PONAB Protein artemis OS=Pongo abelii GN=DCLRE1C PE=2 SV=1 26 184 3.0E-15
sp|Q8C7W7|DCR1B_MOUSE 5' exonuclease Apollo OS=Mus musculus GN=Dclre1b PE=1 SV=2 18 277 5.0E-15
sp|Q96SD1|DCR1C_HUMAN Protein artemis OS=Homo sapiens GN=DCLRE1C PE=1 SV=2 26 184 5.0E-15
sp|Q5QJC2|DCR1C_CHICK Protein artemis OS=Gallus gallus GN=DCLRE1C PE=2 SV=1 36 196 8.0E-14
sp|Q4KLY6|DCR1B_RAT 5' exonuclease Apollo OS=Rattus norvegicus GN=Dclre1b PE=1 SV=2 18 185 2.0E-13
sp|Q6PJP8|DCR1A_HUMAN DNA cross-link repair 1A protein OS=Homo sapiens GN=DCLRE1A PE=1 SV=3 33 185 4.0E-13
sp|B0V2S2|DCR1B_DANRE 5' exonuclease Apollo OS=Danio rerio GN=dclre1b PE=2 SV=1 31 184 9.0E-13
sp|Q5QJC4|DCR1A_CHICK DNA cross-link repair 1A protein OS=Gallus gallus GN=DCLRE1A PE=1 SV=1 36 177 9.0E-13
sp|Q5QJC3|DCR1B_CHICK 5' exonuclease Apollo OS=Gallus gallus GN=DCLRE1B PE=2 SV=1 49 178 1.0E-12
sp|Q9H816|DCR1B_HUMAN 5' exonuclease Apollo OS=Homo sapiens GN=DCLRE1B PE=1 SV=1 36 164 2.0E-12
sp|D2H8V8|DCR1B_AILME 5' exonuclease Apollo OS=Ailuropoda melanoleuca GN=DCLRE1B PE=3 SV=1 36 164 3.0E-12
sp|Q9JIC3|DCR1A_MOUSE DNA cross-link repair 1A protein OS=Mus musculus GN=Dclre1a PE=1 SV=2 31 185 2.0E-11
sp|Q38961|SNM1_ARATH DNA cross-link repair protein SNM1 OS=Arabidopsis thaliana GN=SNM1 PE=2 SV=1 33 185 6.0E-11
sp|Q10264|PSO2_SCHPO DNA cross-link repair protein pso2/snm1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pso2 PE=3 SV=3 48 186 6.0E-09
sp|Q86KS1|DCR1_DICDI DNA cross-link repair 1 protein OS=Dictyostelium discoideum GN=dclre1 PE=3 SV=1 52 185 2.0E-07
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|984
MLLRLERFECRVNYASGILEARRQTYKHLAKVLKPLPLDTPTLIQLGPSNHVQITLFDANHCPGAVMFLIEGGNK
AILYTGDMRSEPWFINSLLRNPLLVEYTAQLKHLDTIYLDTTHTANVAFASKADGIAQLVSQVLQYPPHTVFYIH
AYTYGYEDVWIALSKALNSPIHVDDYKLRIYSSLSHSHPPHQYHLSPSAASLTGYMAANTPRPGCLTTDTAVRLH
SCESANKCAVASAPAVVHIHPIVARLPSGDDMPDKALETDLERRAELAVAPHQESVSRLEDILTSNGVSSSLPDE
TQKRAVQKALGHALSSGRNLLLSIDPLSLDSSHVDAAPTPMSTLLPATNPAPLPSIIKFPYSRHSSYPELCAFVQ
AFKPRDVWPCTANPQQWARQGLSIKSLFGAYCSNTDFAHDTLIQSLTHSYNSDACPSSPIPSQHSPLASPTPILS
GDPNAQATPTPLDPIPAQSCSSPVSSQQSLKRKHDAIDDTSQQSSDSITSTIGPHHSLVRHDAYLSALASASGRQ
WWPVTLLSVDGGHAAADAEL*
Coding >OphauB2|984
ATGCTCTTGCGGCTAGAACGCTTCGAGTGTCGAGTTAATTACGCAAGTGGCATTCTCGAGGCGCGGCGGCAGACG
TATAAGCACCTTGCCAAAGTCTTGAAACCCCTTCCCCTAGATACACCCACCCTCATCCAACTCGGTCCCAGCAAC
CATGTCCAAATAACTCTCTTTGACGCAAACCACTGCCCCGGAGCCGTCATGTTTCTCATCGAGGGCGGCAACAAG
GCCATTCTCTACACTGGCGACATGCGCAGCGAGCCCTGGTTCATCAACTCGCTGCTTCGCAACCCTCTACTCGTC
GAGTACACTGCCCAGCTCAAGCATCTCGATACAATCTACCTCGACACGACGCACACCGCCAACGTTGCCTTTGCC
TCCAAGGCCGACGGCATTGCCCAGCTCGTATCACAAGTGTTACAGTACCCGCCCCATACCGTCTTTTACATTCAC
GCTTATACCTATGGCTACGAAGATGTCTGGATCGCTTTATCCAAGGCCCTCAACTCTCCTATCCACGTAGACGAC
TACAAACTCCGCATCTACTCCTCCCTCTCCCACTCCCATCCCCCTCACCAATACCACCTCTCCCCCTCGGCCGCC
TCGCTAACAGGCTACATGGCCGCCAACACGCCTCGCCCGGGCTGTCTAACCACCGACACCGCCGTCCGTCTGCAC
AGCTGCGAGTCGGCAAACAAGTGCGCCGTGGCCAGCGCCCCGGCCGTCGTGCACATTCACCCCATTGTGGCGCGC
CTGCCGAGCGGCGACGACATGCCGGACAAGGCGCTCGAGACTGACTTGGAGCGCCGCGCAGAGCTGGCTGTGGCG
CCGCATCAAGAGTCTGTCTCGCGGCTAGAAGACATTCTAACTAGCAATGGCGTCTCGTCGTCTCTGCCCGACGAG
ACGCAGAAGCGCGCCGTGCAAAAGGCTCTTGGCCATGCCCTTTCCTCTGGCCGCAACCTCTTGCTCAGCATTGAC
CCTTTATCCCTCGACTCGAGCCACGTCGACGCCGCCCCGACGCCCATGTCAACTCTTTTGCCAGCCACCAATCCA
GCTCCTCTCCCCAGCATCATCAAATTCCCCTACTCGCGCCACTCTTCATACCCCGAGCTCTGCGCATTTGTCCAA
GCCTTTAAGCCCCGCGACGTTTGGCCCTGCACCGCCAACCCTCAACAGTGGGCTCGTCAAGGCCTCTCCATAAAG
TCCCTCTTTGGCGCATACTGCTCCAACACAGACTTTGCCCATGACACACTAATCCAATCCCTCACACACTCTTAC
AACTCGGACGCCTGCCCATCGTCGCCTATACCCTCTCAGCACTCTCCCCTCGCCTCCCCAACGCCCATACTCTCA
GGTGACCCCAACGCACAAGCAACGCCTACCCCGTTGGATCCCATCCCCGCTCAATCGTGTTCAAGCCCCGTTTCC
TCACAACAGTCTCTCAAGCGCAAACACGACGCCATTGACGACACATCGCAACAGTCCTCCGACTCCATCACCTCA
ACCATTGGCCCTCACCACTCCCTCGTCCGCCACGACGCCTACCTCTCTGCTCTCGCCTCCGCCTCGGGAAGGCAG
TGGTGGCCCGTCACTTTGCTATCCGTAGACGGGGGCCACGCCGCTGCTGATGCCGAGCTCTAG
Transcript >OphauB2|984
ATGCTCTTGCGGCTAGAACGCTTCGAGTGTCGAGTTAATTACGCAAGTGGCATTCTCGAGGCGCGGCGGCAGACG
TATAAGCACCTTGCCAAAGTCTTGAAACCCCTTCCCCTAGATACACCCACCCTCATCCAACTCGGTCCCAGCAAC
CATGTCCAAATAACTCTCTTTGACGCAAACCACTGCCCCGGAGCCGTCATGTTTCTCATCGAGGGCGGCAACAAG
GCCATTCTCTACACTGGCGACATGCGCAGCGAGCCCTGGTTCATCAACTCGCTGCTTCGCAACCCTCTACTCGTC
GAGTACACTGCCCAGCTCAAGCATCTCGATACAATCTACCTCGACACGACGCACACCGCCAACGTTGCCTTTGCC
TCCAAGGCCGACGGCATTGCCCAGCTCGTATCACAAGTGTTACAGTACCCGCCCCATACCGTCTTTTACATTCAC
GCTTATACCTATGGCTACGAAGATGTCTGGATCGCTTTATCCAAGGCCCTCAACTCTCCTATCCACGTAGACGAC
TACAAACTCCGCATCTACTCCTCCCTCTCCCACTCCCATCCCCCTCACCAATACCACCTCTCCCCCTCGGCCGCC
TCGCTAACAGGCTACATGGCCGCCAACACGCCTCGCCCGGGCTGTCTAACCACCGACACCGCCGTCCGTCTGCAC
AGCTGCGAGTCGGCAAACAAGTGCGCCGTGGCCAGCGCCCCGGCCGTCGTGCACATTCACCCCATTGTGGCGCGC
CTGCCGAGCGGCGACGACATGCCGGACAAGGCGCTCGAGACTGACTTGGAGCGCCGCGCAGAGCTGGCTGTGGCG
CCGCATCAAGAGTCTGTCTCGCGGCTAGAAGACATTCTAACTAGCAATGGCGTCTCGTCGTCTCTGCCCGACGAG
ACGCAGAAGCGCGCCGTGCAAAAGGCTCTTGGCCATGCCCTTTCCTCTGGCCGCAACCTCTTGCTCAGCATTGAC
CCTTTATCCCTCGACTCGAGCCACGTCGACGCCGCCCCGACGCCCATGTCAACTCTTTTGCCAGCCACCAATCCA
GCTCCTCTCCCCAGCATCATCAAATTCCCCTACTCGCGCCACTCTTCATACCCCGAGCTCTGCGCATTTGTCCAA
GCCTTTAAGCCCCGCGACGTTTGGCCCTGCACCGCCAACCCTCAACAGTGGGCTCGTCAAGGCCTCTCCATAAAG
TCCCTCTTTGGCGCATACTGCTCCAACACAGACTTTGCCCATGACACACTAATCCAATCCCTCACACACTCTTAC
AACTCGGACGCCTGCCCATCGTCGCCTATACCCTCTCAGCACTCTCCCCTCGCCTCCCCAACGCCCATACTCTCA
GGTGACCCCAACGCACAAGCAACGCCTACCCCGTTGGATCCCATCCCCGCTCAATCGTGTTCAAGCCCCGTTTCC
TCACAACAGTCTCTCAAGCGCAAACACGACGCCATTGACGACACATCGCAACAGTCCTCCGACTCCATCACCTCA
ACCATTGGCCCTCACCACTCCCTCGTCCGCCACGACGCCTACCTCTCTGCTCTCGCCTCCGCCTCGGGAAGGCAG
TGGTGGCCCGTCACTTTGCTATCCGTAGACGGGGGCCACGCCGCTGCTGATGCCGAGCTCTAG
Gene >OphauB2|984
ATGCTCTTGCGGCTAGAACGCTTCGAGTGTCGAGTTAATTACGCAAGTGGCATTCTCGAGGCGCGGCGGCAGACG
TATAAGCACCTTGCCAAAGTCTTGGTAAGACTCTACAACCCTATACTCTAGACTCTTCATCTATATAAAACCCTA
CTCCAGACTCTATCTATATAACACCCTACCCCAGACTCAATCTCTTTTATAAAACCTCACCCCAGACTCAATCTC
TTTTTATAAAAAAAAGAAAAAAGAAGAAAAGAGAAAAAAGTCTAGCATCTAACAGATATAGAAACCCCTTCCCCT
AGATACACCCACCCTCATCCAACTCGGTCCCAGCAACCATGTCCAAATAACTCTCTTTGACGCAAACCACTGCCC
CGGAGCCGTCATGTTTCGTACATCCCCCCTACTCCTCCTCCCCAAACCCCTTTTTCCTAACCAGCTCAAACAAGT
CATCGAGGGCGGCAACAAGGCCATTCTCTACACTGGCGACATGCGCAGCGAGCCCTGGTTCATCAACTCGCTGCT
TCGCAACCCTCTACTCGTCGAGTACACTGCCCAGCTCAAGCATCTCGATACAATCTACCTCGACACGACGCACAC
CGCCAACGTTGCCTTTGCCTCCAAGGCCGACGGCATTGCCCAGCTCGTATCACAAGTGTTACAGTACCCGCCCCA
TACCGTCTTTTACATTCACGCTTATACCTATGGCTACGAAGATGTCTGGATCGCTTTATCCAAGGCCCTCAACTC
TCCTGTACTTACCCCCCCCCTTCCATCTCTCTCTCTTCTTACAATCATTTAGATCCACGTAGACGACTACAAACT
CCGCATCTACTCCTCCCTCTCCCACTCCCATCCCCCTCACCAATACCACCTCTCCCCCTCGGCCGCCTCGCTAAC
AGGCTACATGGCCGCCAACACGCCTCGCCCGGGCTGTCTAACCACCGACACCGCCGTCCGTCTGCACAGCTGCGA
GTCGGCAAACAAGTGCGCCGTGGCCAGCGCCCCGGCCGTCGTGCACATTCACCCCATTGTGGCGCGCCTGCCGAG
CGGCGACGACATGCCGGACAAGGCGCTCGAGACTGACTTGGAGCGCCGCGCAGAGCTGGCTGTGGCGCCGCATCA
AGAGTCTGTCTCGCGGCTAGAAGACATTCTAACTAGCAATGGCGTCTCGTCGTCTCTGCCCGACGAGACGCAGAA
GCGCGCCGTGCAAAAGGCTCTTGGCCATGCCCTTTCCTCTGGCCGCAACCTCTTGCTCAGCATTGACCCTTTATC
CCTCGACTCGAGCCACGTCGACGCCGCCCCGACGCCCATGTCAACTCTTTTGCCAGCCACCAATCCAGCTCCTCT
CCCCAGCATCATCAAATTCCCCTACTCGCGCCACTCTTCATACCCCGAGCTCTGCGCATTTGTCCAAGCCTTTAA
GCCCCGCGACGTTTGGCCCTGCACCGCCAACCCTCAACAGTGGGCTCGTCAAGGTATAACCCACGCCTTGCTTTC
ACCTCTTTTTACATTTTACACCTTGTTTTTCTCCCCTTGATAAACGTGCTTGCACTCTACAATATCCCGTGGAAT
TCTCAAAATATACCCGCAAGAGAAAAAACAGCTACTCACTCTCGCTAGGCCTCTCCATAAAGTCCCTCTTTGGCG
CATACTGCTCCAACACAGACTTTGCCCATGACACACTAATCCAATCCCTCACACACTCTTACAACTCGGACGCCT
GCCCATCGTCGCCTATACCCTCTCAGCACTCTCCCCTCGCCTCCCCAACGCCCATACTCTCAGGTGACCCCAACG
CACAAGCAACGCCTACCCCGTTGGATCCCATCCCCGCTCAATCGTGTTCAAGCCCCGTTTCCTCACAACAGTCTC
TCAAGCGCAAACACGACGCCATTGACGACACATCGCAACAGTCCTCCGACTCCATCACCTCAACCATTGGCCCTC
ACCACTCCCTCGTCCGCCACGACGCCTACCTCTCTGCTCTCGCCTCCGCCTCGGGAAGGCAGTGGTGGCCCGTCA
CTTTGCTATCCGTAGACGGGGGCCACGCCGCTGCTGATGCCGAGCTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail