Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|983
Gene name
LocationContig_121:15818..18162
Strand+
Gene length (bp)2344
Transcript length (bp)2193
Coding sequence length (bp)2193
Protein length (aa) 731

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00270 DEAD DEAD/DEAH box helicase 4.8E-39 232 431
PF00271 Helicase_C Helicase conserved C-terminal domain 1.6E-26 488 601

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS2|MAK5_GIBZE ATP-dependent RNA helicase MAK5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MAK5 PE=3 SV=2 5 689 0.0E+00
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 24 689 0.0E+00
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 5 689 0.0E+00
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 24 704 0.0E+00
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 175 698 2.0E-170
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS2|MAK5_GIBZE ATP-dependent RNA helicase MAK5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MAK5 PE=3 SV=2 5 689 0.0E+00
sp|A7EAY2|MAK5_SCLS1 ATP-dependent RNA helicase mak5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=mak5 PE=3 SV=1 24 689 0.0E+00
sp|A4REU9|MAK5_MAGO7 ATP-dependent RNA helicase MAK5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=MAK5 PE=3 SV=2 5 689 0.0E+00
sp|Q7RZH4|MAK5_NEUCR ATP-dependent RNA helicase mak-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mak-5 PE=3 SV=1 24 704 0.0E+00
sp|A6R9U4|MAK5_AJECN ATP-dependent RNA helicase MAK5 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=MAK5 PE=3 SV=1 175 698 2.0E-170
sp|A1CTL8|MAK5_ASPCL ATP-dependent RNA helicase mak5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=mak5 PE=3 SV=1 182 689 6.0E-169
sp|A1DMT9|MAK5_NEOFI ATP-dependent RNA helicase mak5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=mak5 PE=3 SV=1 55 689 2.0E-168
sp|Q2UMY7|MAK5_ASPOR ATP-dependent RNA helicase mak5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=mak5 PE=3 SV=1 55 689 5.0E-167
sp|Q4WMS3|MAK5_ASPFU ATP-dependent RNA helicase mak5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mak5 PE=3 SV=2 182 689 6.0E-164
sp|Q0U6X2|MAK5_PHANO ATP-dependent RNA helicase MAK5 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=MAK5 PE=3 SV=1 62 701 6.0E-161
sp|Q0CI35|MAK5_ASPTN ATP-dependent RNA helicase mak5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=mak5 PE=3 SV=2 178 689 2.0E-157
sp|Q5BCI0|MAK5_EMENI ATP-dependent RNA helicase mak5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=mak5 PE=3 SV=1 207 694 1.0E-156
sp|Q1E7Y4|MAK5_COCIM ATP-dependent RNA helicase MAK5 OS=Coccidioides immitis (strain RS) GN=MAK5 PE=3 SV=1 43 698 6.0E-152
sp|A2QWW0|MAK5_ASPNC ATP-dependent RNA helicase mak5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=mak5 PE=3 SV=1 210 689 1.0E-150
sp|O74393|MAK5_SCHPO ATP-dependent RNA helicase mak5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mak5 PE=1 SV=1 111 690 5.0E-118
sp|A6ZL85|MAK5_YEAS7 ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain YJM789) GN=MAK5 PE=3 SV=1 38 689 2.0E-116
sp|A7TEG8|MAK5_VANPO ATP-dependent RNA helicase MAK5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=MAK5 PE=3 SV=1 61 689 3.0E-116
sp|P38112|MAK5_YEAST ATP-dependent RNA helicase MAK5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MAK5 PE=1 SV=1 38 689 5.0E-116
sp|Q6CTN7|MAK5_KLULA ATP-dependent RNA helicase MAK5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MAK5 PE=3 SV=1 17 689 8.0E-114
sp|A5DUB2|MAK5_LODEL ATP-dependent RNA helicase MAK5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=MAK5 PE=3 SV=1 43 689 4.0E-113
sp|Q6FY67|MAK5_CANGA ATP-dependent RNA helicase MAK5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MAK5 PE=3 SV=1 187 689 1.0E-112
sp|Q59ZH9|MAK5_CANAL ATP-dependent RNA helicase MAK5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MAK5 PE=3 SV=1 203 693 1.0E-112
sp|Q757I6|MAK5_ASHGO ATP-dependent RNA helicase MAK5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MAK5 PE=3 SV=1 206 689 3.0E-110
sp|A5DPU0|MAK5_PICGU ATP-dependent RNA helicase MAK5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=MAK5 PE=3 SV=1 204 691 3.0E-110
sp|A3GG51|MAK5_PICST ATP-dependent RNA helicase MAK5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=MAK5 PE=3 SV=2 204 689 1.0E-108
sp|Q6BV58|MAK5_DEBHA ATP-dependent RNA helicase MAK5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MAK5 PE=3 SV=1 203 690 9.0E-104
sp|P0CQ91|MAK5_CRYNB ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MAK5 PE=3 SV=1 207 689 8.0E-93
sp|P0CQ90|MAK5_CRYNJ ATP-dependent RNA helicase MAK5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MAK5 PE=3 SV=1 207 689 9.0E-93
sp|A3AVH5|RH13_ORYSJ DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. japonica GN=Os04g0510400 PE=2 SV=2 197 698 8.0E-82
sp|A2XVF7|RH13_ORYSI DEAD-box ATP-dependent RNA helicase 13 OS=Oryza sativa subsp. indica GN=OsI_016050 PE=3 SV=2 197 698 8.0E-82
sp|Q54TD7|DDX24_DICDI ATP-dependent RNA helicase ddx24 OS=Dictyostelium discoideum GN=ddx24 PE=3 SV=1 196 689 2.0E-80
sp|Q93Y39|RH13_ARATH DEAD-box ATP-dependent RNA helicase 13 OS=Arabidopsis thaliana GN=RH13 PE=2 SV=3 210 686 1.0E-78
sp|Q9ESV0|DDX24_MOUSE ATP-dependent RNA helicase DDX24 OS=Mus musculus GN=Ddx24 PE=1 SV=2 286 679 4.0E-66
sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1 280 691 6.0E-66
sp|Q5RDL2|DDX24_PONAB ATP-dependent RNA helicase DDX24 OS=Pongo abelii GN=DDX24 PE=2 SV=1 280 691 6.0E-66
sp|Q9SA27|RH36_ARATH DEAD-box ATP-dependent RNA helicase 36 OS=Arabidopsis thaliana GN=RH36 PE=2 SV=1 226 693 6.0E-60
sp|Q8GY84|RH10_ARATH DEAD-box ATP-dependent RNA helicase 10 OS=Arabidopsis thaliana GN=RH10 PE=2 SV=2 226 616 1.0E-57
sp|Q8L4E9|RH36_ORYSJ DEAD-box ATP-dependent RNA helicase 36 OS=Oryza sativa subsp. japonica GN=Os07g0633500 PE=3 SV=1 208 670 9.0E-57
sp|Q6CH58|RRP3_YARLI ATP-dependent rRNA helicase RRP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RRP3 PE=3 SV=1 149 612 7.0E-56
sp|Q55BR9|DDX49_DICDI Probable ATP-dependent RNA helicase ddx49 OS=Dictyostelium discoideum GN=ddx49 PE=3 SV=1 213 616 4.0E-55
sp|Q5B3H7|DBP8_EMENI ATP-dependent RNA helicase dbp8 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp8 PE=3 SV=1 114 611 7.0E-55
sp|Q4P3U9|RRP3_USTMA ATP-dependent rRNA helicase RRP3 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RRP3 PE=3 SV=2 195 626 4.0E-54
sp|Q0U8V9|DBP8_PHANO ATP-dependent RNA helicase DBP8 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP8 PE=3 SV=1 148 610 9.0E-54
sp|A7TK63|DBP8_VANPO ATP-dependent RNA helicase DBP8 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP8 PE=3 SV=1 209 616 1.0E-53
sp|A5DQF1|RRP3_PICGU ATP-dependent rRNA helicase RRP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=RRP3 PE=3 SV=2 198 612 2.0E-53
sp|Q4I662|DBP8_GIBZE ATP-dependent RNA helicase DBP8 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP8 PE=3 SV=1 210 609 2.0E-53
sp|P34580|DDX47_CAEEL Putative ATP-dependent RNA helicase T26G10.1 OS=Caenorhabditis elegans GN=T26G10.1 PE=3 SV=1 210 626 3.0E-53
sp|A5AA68|DBP8_ASPNC ATP-dependent RNA helicase dbp8 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp8 PE=3 SV=1 163 611 5.0E-53
sp|Q9HGM5|DBP8_SCHPO ATP-dependent RNA helicase dbp8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp8 PE=3 SV=1 213 616 5.0E-53
sp|Q0CNX1|DBP8_ASPTN ATP-dependent RNA helicase dbp8 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp8 PE=3 SV=1 139 665 6.0E-53
sp|A6SFV4|DBP8_BOTFB ATP-dependent RNA helicase dbp8 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp8 PE=3 SV=1 161 609 2.0E-52
sp|A1CKJ0|DBP8_ASPCL ATP-dependent RNA helicase dbp8 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp8 PE=3 SV=1 187 665 3.0E-52
sp|Q9H0S4|DDX47_HUMAN Probable ATP-dependent RNA helicase DDX47 OS=Homo sapiens GN=DDX47 PE=1 SV=1 226 622 4.0E-52
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=RRP3 PE=3 SV=1 207 622 4.0E-52
sp|A7E436|DBP8_SCLS1 ATP-dependent RNA helicase dbp8 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp8 PE=3 SV=1 198 648 5.0E-52
sp|Q756G5|DBP8_ASHGO ATP-dependent RNA helicase DBP8 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP8 PE=3 SV=1 204 616 7.0E-52
sp|Q9CWX9|DDX47_MOUSE Probable ATP-dependent RNA helicase DDX47 OS=Mus musculus GN=Ddx47 PE=2 SV=2 226 622 7.0E-52
sp|A1D6X9|DBP8_NEOFI ATP-dependent RNA helicase dbp8 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp8 PE=3 SV=1 206 611 7.0E-52
sp|Q29S22|DDX47_BOVIN Probable ATP-dependent RNA helicase DDX47 OS=Bos taurus GN=DDX47 PE=2 SV=1 226 616 1.0E-51
sp|Q4WXW1|DBP8_ASPFU ATP-dependent RNA helicase dbp8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp8 PE=3 SV=1 206 611 3.0E-51
sp|Q5ACU6|RRP3_CANAL ATP-dependent rRNA helicase RRP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RRP3 PE=3 SV=2 200 612 3.0E-51
sp|Q6BQ61|RRP3_DEBHA ATP-dependent rRNA helicase RRP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RRP3 PE=3 SV=2 151 612 4.0E-51
sp|Q2UKX3|DBP8_ASPOR ATP-dependent RNA helicase dbp8 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp8 PE=3 SV=1 212 610 1.0E-50
sp|A4RGD1|RRP3_MAGO7 ATP-dependent rRNA helicase RRP3 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RRP3 PE=3 SV=1 225 612 2.0E-50
sp|P38719|DBP8_YEAST ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP8 PE=1 SV=1 207 616 2.0E-50
sp|A6ZT77|DBP8_YEAS7 ATP-dependent RNA helicase DBP8 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP8 PE=3 SV=1 207 616 2.0E-50
sp|A2RB17|RRP3_ASPNC ATP-dependent rRNA helicase rrp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=rrp3 PE=3 SV=1 226 616 3.0E-50
sp|A6RW56|RRP3_BOTFB ATP-dependent rRNA helicase rrp3 OS=Botryotinia fuckeliana (strain B05.10) GN=rrp3 PE=3 SV=1 226 612 8.0E-50
sp|Q0CIQ3|RRP3_ASPTN ATP-dependent rRNA helicase rrp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=rrp3 PE=3 SV=2 226 616 9.0E-50
sp|A7EML8|RRP3_SCLS1 ATP-dependent rRNA helicase rrp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=rrp3 PE=3 SV=1 226 616 9.0E-50
sp|Q5B5E7|RRP3_EMENI ATP-dependent rRNA helicase rrp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rrp3 PE=3 SV=1 225 616 9.0E-50
sp|Q54VT4|DDX47_DICDI Probable ATP-dependent RNA helicase ddx47 OS=Dictyostelium discoideum GN=ddx47 PE=3 SV=1 226 622 1.0E-49
sp|Q1E0Z3|DBP8_COCIM ATP-dependent RNA helicase DBP8 OS=Coccidioides immitis (strain RS) GN=DBP8 PE=3 SV=1 208 611 2.0E-49
sp|Q1E1N5|RRP3_COCIM ATP-dependent rRNA helicase RRP3 OS=Coccidioides immitis (strain RS) GN=RRP3 PE=3 SV=1 226 624 2.0E-49
sp|Q0UK12|RRP3_PHANO ATP-dependent rRNA helicase RRP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=RRP3 PE=3 SV=2 225 612 2.0E-49
sp|Q4IFI0|RRP3_GIBZE ATP-dependent rRNA helicase RRP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RRP3 PE=3 SV=1 198 612 3.0E-49
sp|Q9P6N8|RRP3_SCHPO ATP-dependent rRNA helicase rrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rrp3 PE=3 SV=1 226 626 4.0E-49
sp|Q4WJE9|RRP3_ASPFU ATP-dependent rRNA helicase rrp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rrp3 PE=3 SV=1 226 616 9.0E-49
sp|Q6FQZ0|DBP8_CANGA ATP-dependent RNA helicase DBP8 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP8 PE=3 SV=1 213 636 1.0E-48
sp|A3LS22|RRP3_PICST ATP-dependent rRNA helicase RRP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=RRP3 PE=3 SV=3 204 612 3.0E-48
sp|Q7RYZ7|DBP8_NEUCR ATP-dependent RNA helicase dbp-8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-8 PE=3 SV=1 212 611 4.0E-48
sp|P0CR00|RRP3_CRYNJ ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RRP3 PE=3 SV=1 210 626 4.0E-48
sp|P0CR01|RRP3_CRYNB ATP-dependent rRNA helicase RRP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RRP3 PE=3 SV=1 210 626 4.0E-48
sp|A4R8G3|DBP8_MAGO7 ATP-dependent RNA helicase DBP8 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP8 PE=3 SV=3 146 605 4.0E-48
sp|A5DLE0|DBP8_PICGU ATP-dependent RNA helicase DBP8 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP8 PE=3 SV=2 201 630 4.0E-48
sp|A1D405|RRP3_NEOFI ATP-dependent rRNA helicase rrp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=rrp3 PE=3 SV=1 226 616 6.0E-48
sp|P0CQ82|DBP4_CRYNJ ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP4 PE=3 SV=1 206 615 7.0E-48
sp|P0CQ83|DBP4_CRYNB ATP-dependent RNA helicase DBP4 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP4 PE=3 SV=1 206 615 7.0E-48
sp|P38712|RRP3_YEAST ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RRP3 PE=1 SV=2 199 612 7.0E-48
sp|Q75EW9|RRP3_ASHGO ATP-dependent rRNA helicase RRP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RRP3 PE=3 SV=2 213 612 7.0E-48
sp|Q6CXW0|DBP8_KLULA ATP-dependent RNA helicase DBP8 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP8 PE=3 SV=1 208 616 1.0E-47
sp|A6ZSX1|RRP3_YEAS7 ATP-dependent rRNA helicase RRP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=RRP3 PE=3 SV=1 199 612 2.0E-47
sp|A6R3L3|DED1_AJECN ATP-dependent RNA helicase DED1 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DED1 PE=3 SV=1 201 612 2.0E-47
sp|Q4L7W0|CSHA_STAHJ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=cshA PE=3 SV=1 207 622 2.0E-47
sp|Q6BGU8|DBP8_DEBHA ATP-dependent RNA helicase DBP8 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP8 PE=3 SV=2 213 690 3.0E-47
sp|Q6FNK8|RRP3_CANGA ATP-dependent rRNA helicase RRP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RRP3 PE=3 SV=1 210 612 3.0E-47
sp|Q07886|DDX49_DROME Probable ATP-dependent RNA helicase Dbp45A OS=Drosophila melanogaster GN=Dbp45A PE=2 SV=2 213 610 3.0E-47
sp|Q7S2N9|HAS1_NEUCR ATP-dependent RNA helicase has-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=has-1 PE=3 SV=1 205 628 3.0E-47
sp|Q7RY59|RRP3_NEUCR ATP-dependent rRNA helicase rrp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rrp-3 PE=3 SV=1 226 612 4.0E-47
sp|Q5ACK7|DRS1_CANAL ATP-dependent RNA helicase DRS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DRS1 PE=3 SV=1 189 611 7.0E-47
sp|A3LP87|DBP8_PICST ATP-dependent RNA helicase DBP8 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP8 PE=3 SV=2 201 616 7.0E-47
sp|O13370|DED1_SCHPO ATP-dependent RNA helicase ded1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ded1 PE=1 SV=1 201 612 8.0E-47
sp|P0C2N8|DRS1_NEUCR ATP-dependent RNA helicase drs1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-11 PE=3 SV=1 206 614 9.0E-47
sp|Q6C799|DBP8_YARLI ATP-dependent RNA helicase DBP8 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP8 PE=3 SV=1 201 626 2.0E-46
sp|Q59PR3|DBP8_CANAL ATP-dependent RNA helicase DBP8 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP8 PE=3 SV=1 201 609 2.0E-46
sp|Q6C7D2|HAS1_YARLI ATP-dependent RNA helicase HAS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=HAS1 PE=3 SV=1 210 626 3.0E-46
sp|Q5AK59|HAS1_CANAL ATP-dependent RNA helicase HAS1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HAS1 PE=3 SV=1 214 626 3.0E-46
sp|Q6CXB7|HAS1_KLULA ATP-dependent RNA helicase HAS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAS1 PE=3 SV=1 213 626 3.0E-46
sp|A5E0U9|DBP8_LODEL ATP-dependent RNA helicase DBP8 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP8 PE=3 SV=1 201 609 3.0E-46
sp|A1CIQ5|HAS1_ASPCL ATP-dependent RNA helicase has1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=has1 PE=3 SV=1 209 616 4.0E-46
sp|A4QYM6|DRS1_MAGO7 ATP-dependent RNA helicase DRS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DRS1 PE=3 SV=1 208 614 4.0E-46
sp|A6QXC1|DBP3_AJECN ATP-dependent RNA helicase DBP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP3 PE=3 SV=1 228 615 5.0E-46
sp|A3LNR6|HAS1_PICST ATP-dependent RNA helicase HAS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=HAS1 PE=3 SV=2 215 624 5.0E-46
sp|Q5HME0|CSHA_STAEQ DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=cshA PE=3 SV=1 207 622 6.0E-46
sp|Q6FS54|DBP3_CANGA ATP-dependent RNA helicase DBP3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP3 PE=3 SV=1 228 615 6.0E-46
sp|Q7Y183|RH10_ORYSJ DEAD-box ATP-dependent RNA helicase 10 OS=Oryza sativa subsp. japonica GN=Os03g0669000 PE=2 SV=1 219 617 6.0E-46
sp|Q7A0D2|CSHA_STAAW DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MW2) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|Q6G7M9|CSHA_STAAS DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MSSA476) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|Q7A4G0|CSHA_STAAN DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain N315) GN=cshA PE=1 SV=1 213 622 7.0E-46
sp|Q99SH6|CSHA_STAAM DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|Q5HEB9|CSHA_STAAC DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain COL) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|Q2FWH5|CSHA_STAA8 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain NCTC 8325) GN=cshA PE=1 SV=1 213 622 7.0E-46
sp|Q2FF45|CSHA_STAA3 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain USA300) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|A5DID7|HAS1_PICGU ATP-dependent RNA helicase HAS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=HAS1 PE=3 SV=2 189 624 7.0E-46
sp|Q4WQM4|HAS1_ASPFU ATP-dependent RNA helicase has1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=has1 PE=3 SV=2 209 616 7.0E-46
sp|Q6GEZ3|CSHA_STAAR DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain MRSA252) GN=cshA PE=3 SV=1 213 622 7.0E-46
sp|Q74Z73|HAS1_ASHGO ATP-dependent RNA helicase HAS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAS1 PE=3 SV=2 213 626 8.0E-46
sp|A1CW14|HAS1_NEOFI ATP-dependent RNA helicase has1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=has1 PE=3 SV=1 209 616 8.0E-46
sp|Q8CRP6|CSHA_STAES DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=cshA PE=3 SV=1 207 622 8.0E-46
sp|A7TS37|RRP3_VANPO ATP-dependent rRNA helicase RRP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=RRP3 PE=3 SV=1 213 612 8.0E-46
sp|Q49Z29|CSHA_STAS1 DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=cshA PE=3 SV=1 207 622 8.0E-46
sp|A1CR32|RRP3_ASPCL ATP-dependent rRNA helicase rrp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=rrp3 PE=3 SV=1 224 616 9.0E-46
sp|Q6CT85|RRP3_KLULA ATP-dependent rRNA helicase RRP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RRP3 PE=3 SV=1 213 612 9.0E-46
sp|Q2UNB7|RRP3_ASPOR ATP-dependent rRNA helicase rrp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=rrp3 PE=3 SV=1 226 616 1.0E-45
sp|Q755A5|DBP3_ASHGO ATP-dependent RNA helicase DBP3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP3 PE=3 SV=1 191 615 1.0E-45
sp|Q4FZF3|DDX49_MOUSE Probable ATP-dependent RNA helicase DDX49 OS=Mus musculus GN=Ddx49 PE=2 SV=1 207 640 1.0E-45
sp|Q2GMX1|HAS1_CHAGB ATP-dependent RNA helicase HAS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=HAS1 PE=3 SV=1 205 628 2.0E-45
sp|A6QRQ7|RRP3_AJECN ATP-dependent rRNA helicase RRP3 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=RRP3 PE=3 SV=1 225 609 2.0E-45
sp|Q1E2B2|DRS1_COCIM ATP-dependent RNA helicase DRS1 OS=Coccidioides immitis (strain RS) GN=DRS1 PE=3 SV=1 213 614 2.0E-45
sp|Q2UQI6|DRS1_ASPOR ATP-dependent RNA helicase drs1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=drs1 PE=3 SV=2 191 671 3.0E-45
sp|Q2UUN6|HAS1_ASPOR ATP-dependent RNA helicase has1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=has1 PE=3 SV=2 204 616 3.0E-45
sp|Q03532|HAS1_YEAST ATP-dependent RNA helicase HAS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HAS1 PE=1 SV=1 162 624 3.0E-45
sp|Q2H1Q8|RRP3_CHAGB ATP-dependent rRNA helicase RRP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=RRP3 PE=3 SV=1 226 612 4.0E-45
sp|A7F4L5|DRS1_SCLS1 ATP-dependent RNA helicase drs1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=drs1 PE=3 SV=1 210 614 4.0E-45
sp|A4R8B5|HAS1_MAGO7 ATP-dependent RNA helicase HAS1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=HAS1 PE=3 SV=2 213 616 4.0E-45
sp|Q0INC5|RH28_ORYSJ DEAD-box ATP-dependent RNA helicase 28 OS=Oryza sativa subsp. japonica GN=Os12g0481100 PE=2 SV=2 192 644 5.0E-45
sp|Q8TFK8|DED1_CANGA ATP-dependent RNA helicase DED1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DED1 PE=3 SV=1 201 615 6.0E-45
sp|Q0UMB9|DBP4_PHANO ATP-dependent RNA helicase DBP4 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP4 PE=3 SV=1 204 615 7.0E-45
sp|Q6FIL3|HAS1_CANGA ATP-dependent RNA helicase HAS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAS1 PE=3 SV=1 192 626 7.0E-45
sp|Q0UY62|DBP3_PHANO ATP-dependent RNA helicase DBP3 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DBP3 PE=3 SV=1 227 612 7.0E-45
sp|Q2YUH3|CSHA_STAAB DEAD-box ATP-dependent RNA helicase CshA OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=cshA PE=3 SV=1 213 622 8.0E-45
sp|A7TJ36|DBP3_VANPO ATP-dependent RNA helicase DBP3 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP3 PE=3 SV=1 228 615 9.0E-45
sp|A5E2Z9|HAS1_LODEL ATP-dependent RNA helicase HAS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=HAS1 PE=3 SV=1 214 624 9.0E-45
sp|A2QS00|DBP4_ASPNC ATP-dependent RNA helicase dbp4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp4 PE=3 SV=1 204 630 1.0E-44
sp|Q75F95|DRS1_ASHGO ATP-dependent RNA helicase DRS1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DRS1 PE=3 SV=1 210 611 1.0E-44
sp|Q6BH93|HAS1_DEBHA ATP-dependent RNA helicase HAS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAS1 PE=3 SV=1 198 624 1.0E-44
sp|A6RUH2|DRS1_BOTFB ATP-dependent RNA helicase drs1 OS=Botryotinia fuckeliana (strain B05.10) GN=drs1 PE=3 SV=1 210 638 1.0E-44
sp|Q5BFU1|DBP4_EMENI ATP-dependent RNA helicase dbp4 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp4 PE=3 SV=1 213 615 1.0E-44
sp|P0CR02|DBP8_CRYNJ ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP8 PE=3 SV=1 197 612 2.0E-44
sp|P20447|DBP3_YEAST ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP3 PE=1 SV=2 228 615 2.0E-44
sp|A1DNF9|DBP4_NEOFI ATP-dependent RNA helicase dbp4 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp4 PE=3 SV=1 204 615 2.0E-44
sp|Q1EA54|HAS1_COCIM ATP-dependent RNA helicase HAS1 OS=Coccidioides immitis (strain RS) GN=HAS1 PE=3 SV=1 209 616 3.0E-44
sp|A5DKW3|DRS1_PICGU ATP-dependent RNA helicase DRS1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DRS1 PE=3 SV=2 207 611 3.0E-44
sp|A6ZUA1|DBP3_YEAS7 ATP-dependent RNA helicase DBP3 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP3 PE=3 SV=1 228 615 3.0E-44
sp|A3LSN3|DRS1_PICST ATP-dependent RNA helicase DRS1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DRS1 PE=3 SV=3 210 611 4.0E-44
sp|Q4IEK8|HAS1_GIBZE ATP-dependent RNA helicase HAS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAS1 PE=3 SV=2 213 616 5.0E-44
sp|Q9Y6V7|DDX49_HUMAN Probable ATP-dependent RNA helicase DDX49 OS=Homo sapiens GN=DDX49 PE=1 SV=1 207 616 6.0E-44
sp|Q4WM60|DBP4_ASPFU ATP-dependent RNA helicase dbp4 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp4 PE=3 SV=1 213 615 7.0E-44
sp|Q5BBY1|HAS1_EMENI ATP-dependent RNA helicase has1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=has1 PE=3 SV=1 195 616 8.0E-44
sp|Q4I830|DRS1_GIBZE ATP-dependent RNA helicase DRS1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DRS1 PE=3 SV=1 208 612 1.0E-43
sp|A1CTZ2|DBP4_ASPCL ATP-dependent RNA helicase dbp4 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp4 PE=3 SV=1 157 615 1.0E-43
sp|A7TJM9|DRS1_VANPO ATP-dependent RNA helicase DRS1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DRS1 PE=3 SV=1 208 611 1.0E-43
sp|Q0CZN5|DRS1_ASPTN ATP-dependent RNA helicase drs1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=drs1 PE=3 SV=1 213 614 1.0E-43
sp|P0CQ84|HAS1_CRYNJ ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAS1 PE=3 SV=1 145 632 1.0E-43
sp|P0CQ85|HAS1_CRYNB ATP-dependent RNA helicase HAS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAS1 PE=3 SV=1 145 632 1.0E-43
sp|Q4WRV2|DRS1_ASPFU ATP-dependent RNA helicase drs1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=drs1 PE=3 SV=1 213 614 1.0E-43
sp|Q0UR48|HAS1_PHANO ATP-dependent RNA helicase HAS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=HAS1 PE=3 SV=1 206 616 2.0E-43
sp|P0CR03|DBP8_CRYNB ATP-dependent RNA helicase DBP8 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP8 PE=3 SV=1 210 612 2.0E-43
sp|Q5L3G9|CSHA_GEOKA DEAD-box ATP-dependent RNA helicase CshA OS=Geobacillus kaustophilus (strain HTA426) GN=cshA PE=3 SV=1 213 616 2.0E-43
sp|Q54Q94|DDX10_DICDI Probable ATP-dependent RNA helicase ddx10 OS=Dictyostelium discoideum GN=ddx10 PE=3 SV=1 208 641 2.0E-43
sp|P32892|DRS1_YEAST ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS1 PE=1 SV=2 210 611 2.0E-43
sp|A7A0P8|DRS1_YEAS7 ATP-dependent RNA helicase DRS1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DRS1 PE=3 SV=1 210 611 2.0E-43
sp|A7EYW0|DBP3_SCLS1 ATP-dependent RNA helicase dbp3 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp3 PE=3 SV=2 228 612 2.0E-43
sp|Q9Z6C9|CSHA_LACRE ATP-dependent RNA helicase CshA OS=Lactobacillus reuteri GN=cshA PE=3 SV=1 209 616 2.0E-43
sp|Q09916|HAS1_SCHPO ATP-dependent RNA helicase has1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=has1 PE=1 SV=1 206 629 2.0E-43
sp|Q09903|DRS1_SCHPO ATP-dependent RNA helicase drs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=drs1 PE=3 SV=1 208 610 2.0E-43
sp|A1D1R8|DRS1_NEOFI ATP-dependent RNA helicase drs1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=drs1 PE=3 SV=1 213 614 2.0E-43
sp|Q6C9P3|DBP3_YARLI ATP-dependent RNA helicase DBP3 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP3 PE=3 SV=1 228 631 3.0E-43
sp|A2Q9T6|HAS1_ASPNC ATP-dependent RNA helicase has1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=has1 PE=3 SV=1 209 616 3.0E-43
sp|Q96GQ7|DDX27_HUMAN Probable ATP-dependent RNA helicase DDX27 OS=Homo sapiens GN=DDX27 PE=1 SV=2 121 615 3.0E-43
sp|Q6FW42|DRS1_CANGA ATP-dependent RNA helicase DRS1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DRS1 PE=3 SV=1 213 611 3.0E-43
sp|Q5AWA6|DBP3_EMENI ATP-dependent RNA helicase dbp3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp3 PE=3 SV=2 227 612 4.0E-43
sp|Q9ZRZ8|RH28_ARATH DEAD-box ATP-dependent RNA helicase 28 OS=Arabidopsis thaliana GN=RH28 PE=2 SV=1 210 626 5.0E-43
sp|A6SCT6|DBP3_BOTFB ATP-dependent RNA helicase dbp3 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp3 PE=3 SV=1 228 612 5.0E-43
sp|Q1EB31|DBP4_COCIM ATP-dependent RNA helicase DBP4 OS=Coccidioides immitis (strain RS) GN=DBP4 PE=3 SV=1 210 615 6.0E-43
sp|Q6CJV1|DRS1_KLULA ATP-dependent RNA helicase DRS1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DRS1 PE=3 SV=1 210 611 7.0E-43
sp|Q2UHB7|DBP4_ASPOR ATP-dependent RNA helicase dbp4 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp4 PE=3 SV=1 204 615 7.0E-43
sp|A2QAX7|DRS1_ASPNC ATP-dependent RNA helicase drs1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=drs1 PE=3 SV=1 213 664 8.0E-43
sp|Q58083|H669_METJA Probable ATP-dependent RNA helicase MJ0669 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0669 PE=1 SV=1 204 630 1.0E-42
sp|Q88NB7|RHLB_PSEPK ATP-dependent RNA helicase RhlB OS=Pseudomonas putida (strain KT2440) GN=rhlB PE=3 SV=1 213 615 1.0E-42
sp|Q0CMM5|DBP4_ASPTN ATP-dependent RNA helicase dbp4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp4 PE=3 SV=2 204 615 1.0E-42
sp|A1CNV8|DRS1_ASPCL ATP-dependent RNA helicase drs1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=drs1 PE=3 SV=1 213 614 1.0E-42
sp|A5E1W4|DBP3_LODEL ATP-dependent RNA helicase DBP3 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP3 PE=3 SV=2 228 615 2.0E-42
sp|Q4P6N0|HAS1_USTMA ATP-dependent RNA helicase HAS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAS1 PE=3 SV=2 210 626 2.0E-42
sp|Q9HXE5|RHLB_PSEAE ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=rhlB PE=3 SV=1 213 618 3.0E-42
sp|Q02S21|RHLB_PSEAB ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=rhlB PE=3 SV=1 213 618 3.0E-42
sp|B7UUT0|RHLB_PSEA8 ATP-dependent RNA helicase RhlB OS=Pseudomonas aeruginosa (strain LESB58) GN=rhlB PE=3 SV=1 213 618 3.0E-42
sp|A5DQS0|DED1_PICGU ATP-dependent RNA helicase DED1 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DED1 PE=3 SV=3 178 612 3.0E-42
sp|Q0V1Z7|DRS1_PHANO ATP-dependent RNA helicase DRS1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DRS1 PE=3 SV=1 207 614 3.0E-42
sp|Q8SR63|RRP3_ENCCU ATP-dependent rRNA helicase RRP3 OS=Encephalitozoon cuniculi (strain GB-M1) GN=RRP3 PE=3 SV=1 227 616 3.0E-42
sp|A5DY34|DRS1_LODEL ATP-dependent RNA helicase DRS1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DRS1 PE=3 SV=1 213 611 3.0E-42
sp|Q6CEB8|DRS1_YARLI ATP-dependent RNA helicase DRS1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DRS1 PE=3 SV=1 210 611 4.0E-42
sp|Q75B50|DED1_ASHGO ATP-dependent RNA helicase DED1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DED1 PE=3 SV=2 201 612 4.0E-42
sp|Q0UWA6|DED1_PHANO ATP-dependent RNA helicase DED1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=DED1 PE=3 SV=1 207 612 5.0E-42
sp|A3LRW2|DBP3_PICST ATP-dependent RNA helicase DBP3 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP3 PE=3 SV=1 228 615 5.0E-42
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Oryza sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2 213 622 5.0E-42
sp|A1A4H6|DDX27_BOVIN Probable ATP-dependent RNA helicase DDX27 OS=Bos taurus GN=DDX27 PE=2 SV=1 184 615 6.0E-42
sp|Q73EU1|CSHA_BACC1 DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=cshA PE=3 SV=1 213 615 7.0E-42
sp|Q4WH83|DBP3_ASPFU ATP-dependent RNA helicase dbp3 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp3 PE=3 SV=1 228 612 7.0E-42
sp|Q2H2J1|DBP4_CHAGB ATP-dependent RNA helicase DBP4 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP4 PE=3 SV=1 207 615 7.0E-42
sp|Q1DZK8|DBP3_COCIM ATP-dependent RNA helicase DBP3 OS=Coccidioides immitis (strain RS) GN=DBP3 PE=3 SV=2 228 612 8.0E-42
sp|Q6HPE6|CSHA_BACHK DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=cshA PE=3 SV=1 213 615 8.0E-42
sp|Q81VG0|CSHA_BACAN DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus anthracis GN=cshA PE=3 SV=1 213 615 8.0E-42
sp|A0R8U6|CSHA_BACAH DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus thuringiensis (strain Al Hakam) GN=cshA PE=3 SV=1 213 615 8.0E-42
sp|Q63GX5|CSHA_BACCZ DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ZK / E33L) GN=cshA PE=3 SV=1 213 615 9.0E-42
sp|Q8K363|DDX18_MOUSE ATP-dependent RNA helicase DDX18 OS=Mus musculus GN=Ddx18 PE=1 SV=1 220 622 9.0E-42
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DED1 PE=3 SV=1 201 612 1.0E-41
sp|Q0CZS8|HAS1_ASPTN ATP-dependent RNA helicase has1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=has1 PE=3 SV=1 213 616 1.0E-41
sp|P96614|CSHA_BACSU DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus subtilis (strain 168) GN=cshA PE=1 SV=2 213 615 1.0E-41
sp|Q4PFD9|PRP5_USTMA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PRP5 PE=3 SV=1 207 624 1.0E-41
sp|Q6BTL5|DRS1_DEBHA ATP-dependent RNA helicase DRS1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DRS1 PE=3 SV=1 210 611 1.0E-41
sp|Q81IT9|CSHA_BACCR DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshA PE=2 SV=2 213 615 1.0E-41
sp|P0CQ92|DRS1_CRYNJ ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DRS1 PE=3 SV=1 208 611 2.0E-41
sp|P0CQ93|DRS1_CRYNB ATP-dependent RNA helicase DRS1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DRS1 PE=3 SV=1 208 611 2.0E-41
sp|Q54TJ4|DDX27_DICDI Probable ATP-dependent RNA helicase ddx27 OS=Dictyostelium discoideum GN=ddx27 PE=3 SV=1 213 694 2.0E-41
sp|Q5ADL0|PRP5_CANAL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP5 PE=3 SV=1 202 618 2.0E-41
sp|Q9VD51|DDX18_DROME Probable ATP-dependent RNA helicase pitchoune OS=Drosophila melanogaster GN=pit PE=2 SV=2 215 626 3.0E-41
sp|Q887N8|RHLB_PSESM ATP-dependent RNA helicase RhlB OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=rhlB PE=3 SV=1 213 615 3.0E-41
sp|Q61496|DDX4_MOUSE Probable ATP-dependent RNA helicase DDX4 OS=Mus musculus GN=Ddx4 PE=1 SV=2 214 614 3.0E-41
sp|Q4P9P3|DRS1_USTMA ATP-dependent RNA helicase DRS1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DRS1 PE=3 SV=1 208 686 3.0E-41
sp|A1DG51|DBP3_NEOFI ATP-dependent RNA helicase dbp3 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp3 PE=3 SV=1 228 612 3.0E-41
sp|P42305|DBPA_BACSU ATP-dependent RNA helicase DbpA OS=Bacillus subtilis (strain 168) GN=dbpA PE=1 SV=2 207 615 3.0E-41
sp|Q75C76|DBP4_ASHGO ATP-dependent RNA helicase DBP4 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DBP4 PE=3 SV=2 213 615 3.0E-41
sp|Q9P7C7|PRP11_SCHPO Pre-mRNA-processing ATP-dependent RNA helicase prp11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp11 PE=3 SV=1 207 615 4.0E-41
sp|Q6BZ77|DBP3_DEBHA ATP-dependent RNA helicase DBP3 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP3 PE=3 SV=1 228 615 4.0E-41
sp|Q4IJH1|DBP3_GIBZE ATP-dependent RNA helicase DBP3 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP3 PE=3 SV=1 227 612 4.0E-41
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza sativa subsp. japonica GN=Os12g0611200 PE=2 SV=1 209 612 4.0E-41
sp|Q6BU54|DED1_DEBHA ATP-dependent RNA helicase DED1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED1 PE=3 SV=1 228 612 4.0E-41
sp|Q9P6U9|DED1_NEUCR ATP-dependent RNA helicase ded1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-9 PE=3 SV=1 215 612 5.0E-41
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP4 PE=3 SV=2 148 623 5.0E-41
sp|P25888|RHLE_ECOLI ATP-dependent RNA helicase RhlE OS=Escherichia coli (strain K12) GN=rhlE PE=1 SV=3 212 615 6.0E-41
sp|Q2HBE7|DED1_CHAGB ATP-dependent RNA helicase DED1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DED1 PE=3 SV=1 215 612 6.0E-41
sp|Q6CGD1|DBP4_YARLI ATP-dependent RNA helicase DBP4 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP4 PE=3 SV=1 203 628 6.0E-41
sp|O49289|RH29_ARATH Putative DEAD-box ATP-dependent RNA helicase 29 OS=Arabidopsis thaliana GN=RH29 PE=3 SV=1 212 616 7.0E-41
sp|Q2R1M8|RH52C_ORYSJ DEAD-box ATP-dependent RNA helicase 52C OS=Oryza sativa subsp. japonica GN=Os11g0599500 PE=3 SV=1 177 623 7.0E-41
sp|P0CQ79|DBP3_CRYNB ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=DBP3 PE=3 SV=1 228 612 8.0E-41
sp|A2QFL3|DBP3_ASPNC ATP-dependent RNA helicase dbp3 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp3 PE=3 SV=1 142 612 8.0E-41
sp|Q5A4E2|DED1_CANAL ATP-dependent RNA helicase DED1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DED1 PE=3 SV=1 228 612 9.0E-41
sp|P0CQ78|DBP3_CRYNJ ATP-dependent RNA helicase DBP3 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=DBP3 PE=3 SV=1 228 612 9.0E-41
sp|Q9Y7T7|PRP28_SCHPO Pre-mRNA-splicing ATP-dependent RNA helicase prp28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp28 PE=3 SV=1 210 628 9.0E-41
sp|Q65N62|CSHA_BACLD DEAD-box ATP-dependent RNA helicase CshA OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=cshA PE=3 SV=1 213 615 1.0E-40
sp|Q9UTP9|DBP4_SCHPO ATP-dependent RNA helicase dbp4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp4 PE=1 SV=1 207 630 1.0E-40
sp|Q64060|DDX4_RAT Probable ATP-dependent RNA helicase DDX4 OS=Rattus norvegicus GN=Ddx4 PE=1 SV=1 214 610 1.0E-40
sp|A5DAC8|DBP3_PICGU ATP-dependent RNA helicase DBP3 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP3 PE=3 SV=2 228 615 1.0E-40
sp|Q7SH33|PRP5_NEUCR Pre-mRNA-processing ATP-dependent RNA helicase prp-5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prp-5 PE=3 SV=1 207 612 1.0E-40
sp|A6SEH9|DED1_BOTFB ATP-dependent RNA helicase ded1 OS=Botryotinia fuckeliana (strain B05.10) GN=ded1 PE=3 SV=1 228 612 1.0E-40
sp|Q9C551|RH5_ARATH DEAD-box ATP-dependent RNA helicase 5 OS=Arabidopsis thaliana GN=RH5 PE=1 SV=1 201 613 1.0E-40
sp|Q13206|DDX10_HUMAN Probable ATP-dependent RNA helicase DDX10 OS=Homo sapiens GN=DDX10 PE=1 SV=2 206 625 1.0E-40
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DBP2 PE=3 SV=2 219 622 1.0E-40
sp|Q54CD8|DDX54_DICDI ATP-dependent RNA helicase ddx54 OS=Dictyostelium discoideum GN=helA PE=3 SV=1 210 616 1.0E-40
sp|Q4R5S7|DDX4_MACFA Probable ATP-dependent RNA helicase DDX4 OS=Macaca fascicularis GN=DDX4 PE=2 SV=1 214 610 2.0E-40
sp|Q7RZ35|DBP4_NEUCR ATP-dependent RNA helicase dbp-4 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-4 PE=3 SV=1 228 615 2.0E-40
sp|P44586|DEAD_HAEIN ATP-dependent RNA helicase DeaD OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=deaD PE=3 SV=1 205 626 2.0E-40
sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3, chloroplastic OS=Arabidopsis thaliana GN=RH3 PE=1 SV=2 227 622 2.0E-40
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2 SV=2 202 620 2.0E-40
sp|Q5APT8|DBP3_CANAL ATP-dependent RNA helicase DBP3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP3 PE=3 SV=1 228 615 2.0E-40
sp|Q8K4L0|DDX54_MOUSE ATP-dependent RNA helicase DDX54 OS=Mus musculus GN=Ddx54 PE=1 SV=1 210 616 2.0E-40
sp|Q54S03|DDX18_DICDI Probable ATP-dependent RNA helicase ddx18 OS=Dictyostelium discoideum GN=ddx18 PE=3 SV=1 209 616 2.0E-40
sp|Q9NQI0|DDX4_HUMAN Probable ATP-dependent RNA helicase DDX4 OS=Homo sapiens GN=DDX4 PE=1 SV=2 214 610 2.0E-40
sp|Q5ZJF6|DDX10_CHICK Probable ATP-dependent RNA helicase DDX10 OS=Gallus gallus GN=DDX10 PE=2 SV=1 206 615 2.0E-40
sp|Q10202|DBP3_SCHPO ATP-dependent RNA helicase dbp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp3 PE=3 SV=1 177 615 3.0E-40
sp|Q1DJF0|DED1_COCIM ATP-dependent RNA helicase DED1 OS=Coccidioides immitis (strain RS) GN=DED1 PE=3 SV=2 201 612 3.0E-40
sp|A7EJY3|DED1_SCLS1 ATP-dependent RNA helicase ded1 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=ded1 PE=3 SV=1 228 612 3.0E-40
sp|Q8SRB2|DBP2_ENCCU ATP-dependent RNA helicase DBP2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=DBP2 PE=3 SV=1 215 622 3.0E-40
sp|A5DZE6|DED1_LODEL ATP-dependent RNA helicase DED1 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DED1 PE=3 SV=1 228 612 4.0E-40
sp|P0A4D8|CSHA_STRR6 DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=cshA PE=3 SV=1 209 616 4.0E-40
sp|P0A4D7|CSHA_STRPN DEAD-box ATP-dependent RNA helicase CshA OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=cshA PE=3 SV=1 209 616 4.0E-40
sp|Q6FM43|PRP28_CANGA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PRP28 PE=3 SV=1 225 615 4.0E-40
sp|A6ZWD3|DBP1_YEAS7 ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP1 PE=3 SV=1 228 615 5.0E-40
sp|Q80Y44|DDX10_MOUSE Probable ATP-dependent RNA helicase DDX10 OS=Mus musculus GN=Ddx10 PE=1 SV=2 206 615 6.0E-40
sp|Q6CRF4|DBP4_KLULA ATP-dependent RNA helicase DBP4 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP4 PE=3 SV=1 213 615 6.0E-40
sp|Q84W89|RH37_ARATH DEAD-box ATP-dependent RNA helicase 37 OS=Arabidopsis thaliana GN=RH37 PE=2 SV=2 168 623 6.0E-40
sp|P24784|DBP1_YEAST ATP-dependent RNA helicase DBP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP1 PE=1 SV=2 228 615 7.0E-40
sp|Q5W5U4|DDX4_BOVIN Probable ATP-dependent RNA helicase DDX4 OS=Bos taurus GN=DDX4 PE=2 SV=1 214 610 8.0E-40
sp|Q6GWX0|DDX4_PIG Probable ATP-dependent RNA helicase DDX4 OS=Sus scrofa GN=DDX4 PE=2 SV=1 214 610 8.0E-40
sp|P0C2N7|DRS1_CHAGB ATP-dependent RNA helicase DRS1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DRS1 PE=3 SV=1 207 614 9.0E-40
sp|Q9NVP1|DDX18_HUMAN ATP-dependent RNA helicase DDX18 OS=Homo sapiens GN=DDX18 PE=1 SV=2 204 622 9.0E-40
sp|Q921N6|DDX27_MOUSE Probable ATP-dependent RNA helicase DDX27 OS=Mus musculus GN=Ddx27 PE=1 SV=3 122 615 1.0E-39
sp|Q6FPT7|DBP4_CANGA ATP-dependent RNA helicase DBP4 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP4 PE=3 SV=1 213 625 1.0E-39
sp|Q8Y8N0|CSHA_LISMO ATP-dependent RNA helicase CshA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshA PE=2 SV=1 207 707 1.0E-39
sp|Q6CT46|DBP3_KLULA ATP-dependent RNA helicase DBP3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=DBP3 PE=3 SV=1 228 615 1.0E-39
sp|Q1DHB2|PRP5_COCIM Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Coccidioides immitis (strain RS) GN=PRP5 PE=3 SV=1 207 612 2.0E-39
sp|Q2UMH8|DBP3_ASPOR ATP-dependent RNA helicase dbp3 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp3 PE=3 SV=1 228 612 2.0E-39
sp|A7ESL8|DBP4_SCLS1 ATP-dependent RNA helicase dbp4 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp4 PE=3 SV=1 206 615 2.0E-39
sp|P06634|DED1_YEAST ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED1 PE=1 SV=2 201 612 2.0E-39
sp|A6ZP47|DED1_YEAS7 ATP-dependent RNA helicase DED1 OS=Saccharomyces cerevisiae (strain YJM789) GN=DED1 PE=3 SV=1 201 612 2.0E-39
sp|Q3BNH8|RHLB_XANC5 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=rhlB PE=3 SV=1 210 664 3.0E-39
sp|O25029|RHPA_HELPY DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=rhpA PE=1 SV=1 213 626 4.0E-39
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1 180 615 4.0E-39
sp|Q5BDW4|PRP5_EMENI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=prp5 PE=3 SV=1 207 615 4.0E-39
sp|Q4I7K4|DED1_GIBZE ATP-dependent RNA helicase DED1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DED1 PE=3 SV=1 228 612 4.0E-39
sp|Q2HAD8|PRP5_CHAGB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PRP5 PE=3 SV=1 207 612 4.0E-39
sp|Q81DF9|CSHE_BACCR DEAD-box ATP-dependent RNA helicase CshE OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=cshE PE=2 SV=1 205 612 5.0E-39
sp|Q8W4R3|RH30_ARATH DEAD-box ATP-dependent RNA helicase 30 OS=Arabidopsis thaliana GN=RH30 PE=2 SV=2 214 632 5.0E-39
sp|B9XXL6|RHPA_HELP8 DEAD-box ATP-dependent RNA helicase RhpA OS=Helicobacter pylori (strain B128) GN=rhpA PE=1 SV=1 213 626 5.0E-39
sp|P0CQ98|PRP5_CRYNJ Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP5 PE=3 SV=1 207 615 5.0E-39
sp|P0CQ99|PRP5_CRYNB Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP5 PE=3 SV=1 207 615 5.0E-39
sp|Q8PFZ3|RHLB_XANAC ATP-dependent RNA helicase RhlB OS=Xanthomonas axonopodis pv. citri (strain 306) GN=rhlB PE=3 SV=1 210 664 5.0E-39
sp|Q09719|DBP10_SCHPO ATP-dependent RNA helicase dbp10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp10 PE=1 SV=1 203 611 5.0E-39
sp|Q0D1K3|PRP5_ASPTN Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=prp5 PE=3 SV=1 207 615 6.0E-39
sp|A7TKR8|DED1_VANPO ATP-dependent RNA helicase DED1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DED1 PE=3 SV=1 201 612 7.0E-39
sp|Q4IP34|PRP5_GIBZE Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=PRP5 PE=3 SV=2 201 615 7.0E-39
sp|Q5R4I9|DDX5_PONAB Probable ATP-dependent RNA helicase DDX5 OS=Pongo abelii GN=DDX5 PE=2 SV=1 207 616 8.0E-39
sp|Q2U2J6|PRP5_ASPOR Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=prp5 PE=3 SV=1 207 615 8.0E-39
sp|Q7S5R1|DBP3_NEUCR ATP-dependent RNA helicase dbp-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-3 PE=3 SV=1 217 612 1.0E-38
sp|P17844|DDX5_HUMAN Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens GN=DDX5 PE=1 SV=1 207 616 1.0E-38
sp|Q4R6M5|DDX5_MACFA Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis GN=DDX5 PE=2 SV=1 207 616 1.0E-38
sp|A1D373|PRP5_NEOFI Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=prp5 PE=3 SV=1 207 612 1.0E-38
sp|Q9M2F9|RH52_ARATH DEAD-box ATP-dependent RNA helicase 52 OS=Arabidopsis thaliana GN=RH52 PE=1 SV=1 187 623 1.0E-38
sp|Q61656|DDX5_MOUSE Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus GN=Ddx5 PE=1 SV=2 207 616 1.0E-38
sp|A1CH78|DED1_ASPCL ATP-dependent RNA helicase ded1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ded1 PE=3 SV=1 201 612 1.0E-38
sp|Q4HVW2|SPB4_GIBZE ATP-dependent rRNA helicase SPB4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SPB4 PE=3 SV=1 210 613 1.0E-38
sp|Q9BUQ8|DDX23_HUMAN Probable ATP-dependent RNA helicase DDX23 OS=Homo sapiens GN=DDX23 PE=1 SV=3 207 615 2.0E-38
sp|A2QQA8|PRP5_ASPNC Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=prp5 PE=3 SV=2 207 666 2.0E-38
sp|Q2GUI4|DBP3_CHAGB ATP-dependent RNA helicase DBP3 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP3 PE=3 SV=1 228 612 2.0E-38
sp|Q4WT99|PRP5_ASPFU Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=prp5 PE=3 SV=1 207 612 2.0E-38
sp|A1CXK7|DED1_NEOFI ATP-dependent RNA helicase ded1 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ded1 PE=3 SV=1 201 612 2.0E-38
sp|A1CQA9|PRP5_ASPCL Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=prp5 PE=3 SV=1 207 633 2.0E-38
sp|A1C5V3|DBP3_ASPCL ATP-dependent RNA helicase dbp3 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp3 PE=3 SV=1 228 612 2.0E-38
sp|Q4IAS1|DBP4_GIBZE ATP-dependent RNA helicase DBP4 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP4 PE=3 SV=1 228 615 3.0E-38
sp|Q6FU81|MS116_CANGA ATP-dependent RNA helicase MSS116, mitochondrial OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MSS116 PE=3 SV=1 132 689 3.0E-38
sp|Q8P4D4|RHLB_XANCP ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=rhlB PE=3 SV=1 210 608 4.0E-38
sp|B0RWT6|RHLB_XANCB ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain B100) GN=rhlB PE=3 SV=1 210 608 4.0E-38
sp|Q4UPY5|RHLB_XANC8 ATP-dependent RNA helicase RhlB OS=Xanthomonas campestris pv. campestris (strain 8004) GN=rhlB PE=3 SV=1 210 608 4.0E-38
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 OS=Dictyostelium discoideum GN=ddx17 PE=3 SV=1 219 615 4.0E-38
sp|A7TJ71|DBP4_VANPO ATP-dependent RNA helicase DBP4 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP4 PE=3 SV=1 213 615 4.0E-38
sp|Q1EB38|DBP10_COCIM ATP-dependent RNA helicase DBP10 OS=Coccidioides immitis (strain RS) GN=DBP10 PE=3 SV=1 210 644 4.0E-38
sp|Q6BXG0|DBP4_DEBHA ATP-dependent RNA helicase DBP4 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP4 PE=3 SV=2 227 615 4.0E-38
sp|Q55804|CRHR_SYNY3 RNA helicase CrhR OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=crhR PE=1 SV=1 213 671 5.0E-38
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP2 PE=3 SV=1 223 623 5.0E-38
sp|Q5GUR8|RHLB_XANOR ATP-dependent RNA helicase RhlB OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=rhlB PE=3 SV=2 210 608 5.0E-38
sp|A5A6J2|DDX5_PANTR Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes GN=DDX5 PE=2 SV=1 207 616 6.0E-38
sp|A6QUM7|DBP10_AJECN ATP-dependent RNA helicase DBP10 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP10 PE=3 SV=1 210 698 6.0E-38
sp|P24346|DDX3_XENLA Putative ATP-dependent RNA helicase an3 OS=Xenopus laevis GN=an3 PE=2 SV=1 228 622 7.0E-38
sp|P21693|DBPA_ECOLI ATP-dependent RNA helicase DbpA OS=Escherichia coli (strain K12) GN=dbpA PE=1 SV=2 215 615 8.0E-38
sp|Q75HJ0|RH37_ORYSJ DEAD-box ATP-dependent RNA helicase 37 OS=Oryza sativa subsp. japonica GN=PL10A PE=2 SV=1 199 612 8.0E-38
sp|Q5RC67|DDX23_PONAB Probable ATP-dependent RNA helicase DDX23 OS=Pongo abelii GN=DDX23 PE=2 SV=1 207 612 9.0E-38
sp|A4RHF1|DED1_MAGO7 ATP-dependent RNA helicase DED1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DED1 PE=3 SV=2 201 610 1.0E-37
sp|Q2UGK3|DED1_ASPOR ATP-dependent RNA helicase ded1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ded1 PE=3 SV=1 215 612 1.0E-37
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp2 PE=3 SV=1 219 638 1.0E-37
sp|Q4WP13|DED1_ASPFU ATP-dependent RNA helicase ded1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ded1 PE=3 SV=1 201 612 1.0E-37
sp|Q6GVM6|DDX3Y_PANTR ATP-dependent RNA helicase DDX3Y OS=Pan troglodytes GN=DDX3Y PE=2 SV=1 203 622 1.0E-37
sp|A4RGU2|DBP4_MAGO7 ATP-dependent RNA helicase DBP4 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP4 PE=3 SV=1 210 615 2.0E-37
sp|A3LQ01|DED1_PICST ATP-dependent RNA helicase DED1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DED1 PE=3 SV=3 228 612 2.0E-37
sp|A6RW79|PRP5_BOTFB Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Botryotinia fuckeliana (strain B05.10) GN=prp5 PE=3 SV=1 201 612 2.0E-37
sp|A1CTZ6|DBP10_ASPCL ATP-dependent RNA helicase dbp10 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp10 PE=3 SV=1 210 611 2.0E-37
sp|A5DLF4|DBP4_PICGU ATP-dependent RNA helicase DBP4 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP4 PE=3 SV=2 207 615 2.0E-37
sp|Q0CL13|DBP3_ASPTN ATP-dependent RNA helicase dbp3 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp3 PE=3 SV=1 228 612 2.0E-37
sp|Q761Z9|RH18_ORYSJ DEAD-box ATP-dependent RNA helicase 18 OS=Oryza sativa subsp. japonica GN=Os01g0164500 PE=1 SV=2 215 615 2.0E-37
sp|Q8LA13|RH11_ARATH DEAD-box ATP-dependent RNA helicase 11 OS=Arabidopsis thaliana GN=RH11 PE=1 SV=1 201 623 2.0E-37
sp|Q6CKI1|PRP5_KLULA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP5 PE=3 SV=1 171 623 2.0E-37
sp|Q6C7X8|DBP10_YARLI ATP-dependent RNA helicase DBP10 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP10 PE=3 SV=1 210 616 2.0E-37
sp|Q8NJM2|DBP10_ASPFU ATP-dependent RNA helicase dbp10 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp10 PE=3 SV=1 210 611 3.0E-37
sp|P90897|RDE12_CAEEL DEAD-box ATP-dependent RNA helicase rde-12 OS=Caenorhabditis elegans GN=rde-12 PE=1 SV=4 204 613 3.0E-37
sp|Q6YS30|RH5_ORYSJ DEAD-box ATP-dependent RNA helicase 5 OS=Oryza sativa subsp. japonica GN=Os07g0301200 PE=2 SV=1 171 607 3.0E-37
sp|A6RGE3|DBP2_AJECN ATP-dependent RNA helicase DBP2 OS=Ajellomyces capsulatus (strain NAm1 / WU24) GN=DBP2 PE=3 SV=1 219 638 3.0E-37
sp|A2QI25|DED1_ASPNC ATP-dependent RNA helicase ded1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ded1 PE=3 SV=1 201 612 4.0E-37
sp|A3GGE9|DBP4_PICST ATP-dependent RNA helicase DBP4 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=DBP4 PE=3 SV=2 207 615 4.0E-37
sp|Q4P733|DED1_USTMA ATP-dependent RNA helicase DED1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=DED1 PE=3 SV=1 228 605 4.0E-37
sp|Q4TVV3|DDX46_DANRE Probable ATP-dependent RNA helicase DDX46 OS=Danio rerio GN=ddx46 PE=2 SV=1 207 612 4.0E-37
sp|C8V8H4|DED1_EMENI ATP-dependent RNA helicase ded1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ded1 PE=3 SV=1 201 612 4.0E-37
sp|Q6FP38|DBP1_CANGA ATP-dependent RNA helicase DBP1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP1 PE=3 SV=1 207 616 5.0E-37
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1 213 640 5.0E-37
sp|Q84UQ1|RH42_ORYSJ DEAD-box ATP-dependent RNA helicase 42 OS=Oryza sativa subsp. japonica GN=Os08g0159900 PE=2 SV=1 207 615 5.0E-37
sp|A5DF03|PRP28_PICGU Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP28 PE=3 SV=2 210 611 5.0E-37
sp|O22907|RH24_ARATH DEAD-box ATP-dependent RNA helicase 24 OS=Arabidopsis thaliana GN=RH24 PE=1 SV=2 201 612 6.0E-37
sp|Q9UJV9|DDX41_HUMAN Probable ATP-dependent RNA helicase DDX41 OS=Homo sapiens GN=DDX41 PE=1 SV=2 227 612 6.0E-37
sp|A4RN46|PRP5_MAGO7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP5 PE=3 SV=1 201 612 7.0E-37
sp|O76743|GLH4_CAEEL ATP-dependent RNA helicase glh-4 OS=Caenorhabditis elegans GN=glh-4 PE=1 SV=2 229 610 7.0E-37
sp|A7ENE0|PRP5_SCLS1 Pre-mRNA-processing ATP-dependent RNA helicase prp5 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=prp5 PE=3 SV=1 207 612 7.0E-37
sp|Q6Z4K6|RH52B_ORYSJ DEAD-box ATP-dependent RNA helicase 52B OS=Oryza sativa subsp. japonica GN=PL10B PE=2 SV=1 228 612 7.0E-37
sp|A1DNG2|DBP10_NEOFI ATP-dependent RNA helicase dbp10 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp10 PE=3 SV=1 210 611 7.0E-37
sp|Q9DF36|DD21B_XENLA Nucleolar RNA helicase 2-B OS=Xenopus laevis GN=ddx21-b PE=2 SV=2 234 613 7.0E-37
sp|Q0CLJ6|DED1_ASPTN ATP-dependent RNA helicase ded1 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ded1 PE=3 SV=1 201 612 8.0E-37
sp|Q553B1|DDX46_DICDI ATP-dependent RNA helicase ddx46 OS=Dictyostelium discoideum GN=helB1 PE=2 SV=1 207 615 9.0E-37
sp|A5DDF4|PRP5_PICGU Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=PRP5 PE=3 SV=2 207 611 9.0E-37
sp|Q91VN6|DDX41_MOUSE Probable ATP-dependent RNA helicase DDX41 OS=Mus musculus GN=Ddx41 PE=1 SV=2 227 612 9.0E-37
sp|Q6BML1|PRP5_DEBHA Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP5 PE=3 SV=2 207 612 9.0E-37
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DBP2 PE=3 SV=1 219 628 1.0E-36
sp|Q0DBS1|RH51_ORYSJ Putative DEAD-box ATP-dependent RNA helicase 51 OS=Oryza sativa subsp. japonica GN=Os06g0535100 PE=3 SV=2 223 685 1.0E-36
sp|A3LQ55|PRP5_PICST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=PRP5 PE=3 SV=2 207 615 1.0E-36
sp|Q7S9J4|DBP10_NEUCR ATP-dependent RNA helicase dbp-10 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=dbp-10 PE=3 SV=1 210 616 1.0E-36
sp|A6ZPU3|DBP4_YEAS7 ATP-dependent RNA helicase DBP4 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP4 PE=3 SV=1 227 615 1.0E-36
sp|Q5BFU7|DBP10_EMENI ATP-dependent RNA helicase dbp10 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=dbp10 PE=3 SV=1 210 611 1.0E-36
sp|Q879Y6|RHLB_XYLFT ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=rhlB PE=3 SV=1 209 600 1.0E-36
sp|Q8Y755|CSHB_LISMO DEAD-box ATP-dependent RNA helicase CshB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cshB PE=2 SV=1 222 613 1.0E-36
sp|P20448|DBP4_YEAST ATP-dependent RNA helicase HCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HCA4 PE=1 SV=2 227 615 1.0E-36
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp2 PE=3 SV=1 219 638 1.0E-36
sp|O15523|DDX3Y_HUMAN ATP-dependent RNA helicase DDX3Y OS=Homo sapiens GN=DDX3Y PE=1 SV=2 204 622 1.0E-36
sp|Q5RF43|DDX3Y_PONAB ATP-dependent RNA helicase DDX3Y OS=Pongo abelii GN=DDX3Y PE=2 SV=1 204 622 2.0E-36
sp|A6ZLH6|PRP5_YEAS7 Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain YJM789) GN=PRP5 PE=3 SV=1 207 616 2.0E-36
sp|A7TJK8|PRP5_VANPO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=PRP5 PE=3 SV=1 207 638 2.0E-36
sp|P21372|PRP5_YEAST Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP5 PE=1 SV=1 207 616 2.0E-36
sp|Q8Y7M8|DBPA_LISMO ATP-dependent RNA helicase DbpA OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dbpA PE=2 SV=1 213 640 2.0E-36
sp|Q8TDD1|DDX54_HUMAN ATP-dependent RNA helicase DDX54 OS=Homo sapiens GN=DDX54 PE=1 SV=2 210 616 3.0E-36
sp|Q10MH8|RH24_ORYSJ DEAD-box ATP-dependent RNA helicase 24 OS=Oryza sativa subsp. japonica GN=Os03g0308500 PE=2 SV=1 201 616 3.0E-36
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=dbp2 PE=3 SV=1 219 638 3.0E-36
sp|A5E3K3|DBP4_LODEL ATP-dependent RNA helicase DBP4 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=DBP4 PE=3 SV=1 207 615 3.0E-36
sp|P24782|DBP2_SCHPO ATP-dependent RNA helicase dbp2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dbp2 PE=2 SV=2 219 624 3.0E-36
sp|Q6CB69|DED1_YARLI ATP-dependent RNA helicase DED1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=DED1 PE=3 SV=1 201 612 3.0E-36
sp|Q62167|DDX3X_MOUSE ATP-dependent RNA helicase DDX3X OS=Mus musculus GN=Ddx3x PE=1 SV=3 187 622 4.0E-36
sp|Q9LIH9|RH51_ARATH DEAD-box ATP-dependent RNA helicase 51 OS=Arabidopsis thaliana GN=RH51 PE=2 SV=1 212 629 4.0E-36
sp|A5E058|PRP5_LODEL Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=PRP5 PE=3 SV=1 210 611 5.0E-36
sp|A7E449|DBP2_SCLS1 ATP-dependent RNA helicase dbp2 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp2 PE=3 SV=1 219 623 5.0E-36
sp|A2QRY2|DBP10_ASPNC ATP-dependent RNA helicase dbp10 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp10 PE=3 SV=1 210 611 5.0E-36
sp|Q6BLU9|PRP28_DEBHA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PRP28 PE=3 SV=2 202 611 5.0E-36
sp|A6SFW7|DBP2_BOTFB ATP-dependent RNA helicase dbp2 OS=Botryotinia fuckeliana (strain B05.10) GN=dbp2 PE=3 SV=2 219 623 5.0E-36
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=dbp2 PE=3 SV=1 219 638 6.0E-36
sp|Q9FNM7|RH26_ARATH DEAD-box ATP-dependent RNA helicase 26 OS=Arabidopsis thaliana GN=RH26 PE=1 SV=2 215 613 7.0E-36
sp|Q5R6D8|DDX46_PONAB Probable ATP-dependent RNA helicase DDX46 OS=Pongo abelii GN=DDX46 PE=2 SV=1 207 615 8.0E-36
sp|Q7SBC6|DBP2_NEUCR ATP-dependent RNA helicase dbp2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=drh-1 PE=3 SV=2 223 638 8.0E-36
sp|Q94C75|RH25_ARATH DEAD-box ATP-dependent RNA helicase 25 OS=Arabidopsis thaliana GN=RH25 PE=2 SV=2 190 615 8.0E-36
sp|Q59W52|PRP28_CANAL Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PRP28 PE=3 SV=1 210 612 9.0E-36
sp|O00571|DDX3X_HUMAN ATP-dependent RNA helicase DDX3X OS=Homo sapiens GN=DDX3X PE=1 SV=3 187 622 9.0E-36
sp|Q3MSQ8|DDX4_PELLE Probable ATP-dependent RNA helicase DDX4 OS=Pelophylax lessonae GN=ddx4 PE=2 SV=1 201 610 1.0E-35
sp|Q5AF95|DBP4_CANAL ATP-dependent RNA helicase DBP4 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DBP4 PE=3 SV=1 164 615 1.0E-35
sp|Q8H0U8|RH42_ARATH DEAD-box ATP-dependent RNA helicase 42 OS=Arabidopsis thaliana GN=RH42 PE=1 SV=2 210 615 1.0E-35
sp|Q1K8F7|CYT19_NEUCR ATP-dependent RNA helicase cyt-19, mitochondrial OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cyt-19 PE=1 SV=1 198 605 1.0E-35
sp|Q9V3C0|DDX41_DROME ATP-dependent RNA helicase abstrakt OS=Drosophila melanogaster GN=abs PE=1 SV=1 213 612 1.0E-35
sp|Q2UHC1|DBP10_ASPOR ATP-dependent RNA helicase dbp10 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=dbp10 PE=3 SV=1 210 611 2.0E-35
sp|Q569Z5|DDX46_MOUSE Probable ATP-dependent RNA helicase DDX46 OS=Mus musculus GN=Ddx46 PE=1 SV=2 207 615 2.0E-35
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=dbp2 PE=3 SV=1 219 638 2.0E-35
sp|Q62780|DDX46_RAT Probable ATP-dependent RNA helicase DDX46 OS=Rattus norvegicus GN=Ddx46 PE=1 SV=1 207 615 2.0E-35
sp|Q7L014|DDX46_HUMAN Probable ATP-dependent RNA helicase DDX46 OS=Homo sapiens GN=DDX46 PE=1 SV=2 207 615 2.0E-35
sp|P16381|DDX3L_MOUSE Putative ATP-dependent RNA helicase Pl10 OS=Mus musculus GN=D1Pas1 PE=1 SV=1 187 622 2.0E-35
sp|Q54IV3|DDX42_DICDI Probable ATP-dependent RNA helicase ddx42 OS=Dictyostelium discoideum GN=ddx42 PE=3 SV=1 219 616 3.0E-35
sp|A2QE29|SPB4_ASPNC ATP-dependent rRNA helicase spb4 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=spb4 PE=3 SV=2 215 613 3.0E-35
sp|Q2H0R2|DBP10_CHAGB ATP-dependent RNA helicase DBP10 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP10 PE=3 SV=1 198 611 3.0E-35
sp|Q814I2|DBPA_BACCR ATP-dependent RNA helicase DbpA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=dbpA PE=2 SV=1 215 615 3.0E-35
sp|Q4HZ42|DBP10_GIBZE ATP-dependent RNA helicase DBP10 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=DBP10 PE=3 SV=1 210 611 3.0E-35
sp|Q6CT49|PRP28_KLULA Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PRP28 PE=3 SV=1 202 615 4.0E-35
sp|Q99MJ9|DDX50_MOUSE ATP-dependent RNA helicase DDX50 OS=Mus musculus GN=Ddx50 PE=2 SV=1 213 615 5.0E-35
sp|P44701|SRMB_HAEIN ATP-dependent RNA helicase SrmB OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=srmB PE=3 SV=1 205 611 5.0E-35
sp|Q1DP69|DBP2_COCIM ATP-dependent RNA helicase DBP2 OS=Coccidioides immitis (strain RS) GN=DBP2 PE=3 SV=2 219 638 5.0E-35
sp|Q501J6|DDX17_MOUSE Probable ATP-dependent RNA helicase DDX17 OS=Mus musculus GN=Ddx17 PE=1 SV=1 202 622 5.0E-35
sp|Q06218|DBP9_YEAST ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP9 PE=1 SV=1 206 613 5.0E-35
sp|A7A1G0|DBP9_YEAS7 ATP-dependent RNA helicase DBP9 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP9 PE=3 SV=1 206 613 5.0E-35
sp|Q9FFQ1|RH31_ARATH DEAD-box ATP-dependent RNA helicase 31 OS=Arabidopsis thaliana GN=RH31 PE=2 SV=2 215 613 5.0E-35
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=dbp2 PE=3 SV=2 219 638 5.0E-35
sp|P21507|SRMB_ECOLI ATP-dependent RNA helicase SrmB OS=Escherichia coli (strain K12) GN=srmB PE=1 SV=1 227 617 5.0E-35
sp|P9WH05|DEAD_MYCTU ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=deaD PE=1 SV=1 208 616 5.0E-35
sp|P9WH04|DEAD_MYCTO ATP-dependent RNA helicase DeaD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=deaD PE=3 SV=1 208 616 5.0E-35
sp|Q2FY15|CSHB_STAA8 DEAD-box ATP-dependent RNA helicase CshB OS=Staphylococcus aureus (strain NCTC 8325) GN=cshB PE=3 SV=1 213 615 5.0E-35
sp|Q54Y81|DDX23_DICDI ATP-dependent RNA helicase ddx23 OS=Dictyostelium discoideum GN=helB2 PE=2 SV=1 207 616 6.0E-35
sp|A7ESL7|DBP10_SCLS1 ATP-dependent RNA helicase dbp10 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=dbp10 PE=3 SV=2 210 611 6.0E-35
sp|A7TPC9|DBP9_VANPO ATP-dependent RNA helicase DBP9 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=DBP9 PE=3 SV=2 206 673 6.0E-35
sp|Q9C718|RH20_ARATH DEAD-box ATP-dependent RNA helicase 20 OS=Arabidopsis thaliana GN=RH20 PE=2 SV=1 219 612 6.0E-35
sp|Q53RK8|RH21_ORYSJ DEAD-box ATP-dependent RNA helicase 21 OS=Oryza sativa subsp. japonica GN=Os03g0708600 PE=2 SV=1 209 612 7.0E-35
sp|A2YV85|RH29_ORYSI DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. indica GN=OsI_028228 PE=2 SV=2 227 616 7.0E-35
sp|A3BT52|RH29_ORYSJ DEAD-box ATP-dependent RNA helicase 29 OS=Oryza sativa subsp. japonica GN=Os08g0416100 PE=2 SV=2 227 616 8.0E-35
sp|Q6BLM5|DBP9_DEBHA ATP-dependent RNA helicase DBP9 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DBP9 PE=3 SV=1 206 613 1.0E-34
sp|Q2H720|DBP2_CHAGB ATP-dependent RNA helicase DBP2 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=DBP2 PE=3 SV=1 223 628 1.0E-34
sp|Q9VHP0|DDX3_DROME ATP-dependent RNA helicase bel OS=Drosophila melanogaster GN=bel PE=1 SV=1 179 612 1.0E-34
sp|Q8SR49|SPB4_ENCCU ATP-dependent rRNA helicase SPB4 OS=Encephalitozoon cuniculi (strain GB-M1) GN=SPB4 PE=3 SV=1 227 615 1.0E-34
sp|Q92841|DDX17_HUMAN Probable ATP-dependent RNA helicase DDX17 OS=Homo sapiens GN=DDX17 PE=1 SV=2 202 622 1.0E-34
sp|P24783|DBP2_YEAST ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DBP2 PE=1 SV=1 219 612 1.0E-34
sp|A6ZRX0|DBP2_YEAS7 ATP-dependent RNA helicase DBP2 OS=Saccharomyces cerevisiae (strain YJM789) GN=DBP2 PE=3 SV=1 219 612 1.0E-34
sp|P34689|GLH1_CAEEL ATP-dependent RNA helicase glh-1 OS=Caenorhabditis elegans GN=glh-1 PE=1 SV=3 214 617 2.0E-34
sp|Q0CQF3|SPB4_ASPTN ATP-dependent rRNA helicase spb4 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=spb4 PE=3 SV=1 209 613 2.0E-34
sp|Q9PA24|RHLB_XYLFA ATP-dependent RNA helicase RhlB OS=Xylella fastidiosa (strain 9a5c) GN=rhlB PE=3 SV=2 209 600 2.0E-34
sp|Q91372|DDX4_XENLA Probable ATP-dependent RNA helicase DDX4 OS=Xenopus laevis GN=ddx4 PE=2 SV=1 214 618 2.0E-34
sp|P54475|CSHB_BACSU DEAD-box ATP-dependent RNA helicase CshB OS=Bacillus subtilis (strain 168) GN=cshB PE=1 SV=1 215 611 2.0E-34
sp|A5DL80|DBP2_PICGU ATP-dependent RNA helicase DBP2 OS=Meyerozyma guilliermondii (strain ATCC 6260 / CBS 566 / DSM 6381 / JCM 1539 / NBRC 10279 / NRRL Y-324) GN=DBP2 PE=3 SV=3 219 612 3.0E-34
sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo sapiens GN=DDX50 PE=1 SV=1 215 615 3.0E-34
sp|Q62095|DDX3Y_MOUSE ATP-dependent RNA helicase DDX3Y OS=Mus musculus GN=Ddx3y PE=1 SV=2 228 622 3.0E-34
sp|Q6FLF3|DBP2_CANGA ATP-dependent RNA helicase DBP2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DBP2 PE=3 SV=1 219 615 3.0E-34
sp|Q754U8|PRP5_ASHGO Pre-mRNA-processing ATP-dependent RNA helicase PRP5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PRP5 PE=3 SV=2 207 622 4.0E-34
sp|Q0CMM8|DBP10_ASPTN ATP-dependent RNA helicase dbp10 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=dbp10 PE=3 SV=1 210 611 4.0E-34
sp|P0CQ88|PRP28_CRYNJ Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PRP28 PE=3 SV=1 210 622 4.0E-34
sp|P0CQ89|PRP28_CRYNB Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PRP28 PE=3 SV=1 210 622 4.0E-34
sp|Q9DF35|DD21A_XENLA Nucleolar RNA helicase 2-A OS=Xenopus laevis GN=ddx21-a PE=2 SV=2 209 613 5.0E-34
sp|P09052|VASA1_DROME ATP-dependent RNA helicase vasa, isoform A OS=Drosophila melanogaster GN=vas PE=1 SV=3 183 615 5.0E-34
sp|Q6BT27|FAL1_DEBHA ATP-dependent RNA helicase FAL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=FAL1 PE=3 SV=1 208 645 6.0E-34
sp|A4RK80|PRP28_MAGO7 Pre-mRNA-splicing ATP-dependent RNA helicase PRP28 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PRP28 PE=3 SV=1 210 615 7.0E-34
sp|P93008|RH21_ARATH DEAD-box ATP-dependent RNA helicase 21 OS=Arabidopsis thaliana GN=RH21 PE=2 SV=1 210 612 7.0E-34
sp|Q6C347|FAL1_YARLI ATP-dependent RNA helicase FAL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=FAL1 PE=3 SV=1 201 645 9.0E-34
sp|A6RMZ2|SPB4_BOTFB ATP-dependent rRNA helicase spb4 OS=Botryotinia fuckeliana (strain B05.10) GN=spb4 PE=3 SV=1 210 613 9.0E-34
sp|A4QSS5|DBP2_MAGO7 ATP-dependent RNA helicase DBP2 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=DBP2 PE=3 SV=1 223 622 1.0E-33
sp|Q5QMN3|RH20_ORYSJ DEAD-box ATP-dependent RNA helicase 20 OS=Oryza sativa subsp. japonica GN=Os01g0197200 PE=3 SV=2 207 612 1.0E-33
sp|Q9SB89|RH27_ARATH DEAD-box ATP-dependent RNA helicase 27 OS=Arabidopsis thaliana GN=RH27 PE=2 SV=2 210 644 1.0E-33
sp|Q9ESV0|DDX24_MOUSE ATP-dependent RNA helicase DDX24 OS=Mus musculus GN=Ddx24 PE=1 SV=2 197 272 9.0E-09
sp|Q9GZR7|DDX24_HUMAN ATP-dependent RNA helicase DDX24 OS=Homo sapiens GN=DDX24 PE=1 SV=1 206 272 4.0E-08
sp|Q5RDL2|DDX24_PONAB ATP-dependent RNA helicase DDX24 OS=Pongo abelii GN=DDX24 PE=2 SV=1 206 272 5.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0003676 nucleic acid binding Yes
GO:0017076 purine nucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0030554 adenyl nucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032553 ribonucleotide binding No
GO:0043168 anion binding No
GO:0036094 small molecule binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0097367 carbohydrate derivative binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 41 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|983
MVSLKKRKLAAGSGPAPKRTKRQDERRKGEERPTGNDKTEAPRRNTKAAASRGRVVDATSLAWKPVGEEFGELQV
ITGVQVVKHGDKVEFLVKEIEDGQDATAEESEEQEESFEGFGDDVVESKDVDSGKAGGVEAGLQGEEPRCQDSAK
ESASKKKSERAAEQRGKTSKNKTSKKQPAVGDAGLEAGNSFEPLVAMAQDSGGDVDVAEWVALNLSTGMLSCVAG
LGFSQPTRIQRMAIAEILAGQDVIGKAETGSGKTLAFGIPIVEKWLEVKESAQDEADDDGQRCIMAVVLSPTREL
AKQLGDHLKALCRQADPAPRICVVTGGLSIQKQQRQLAQANVIIATPGRLWEVMDGDAPLQEALSRTHFLVIDEA
DRLLQAGQFEEARSIIGALDRCAPGAEAAEEEQQRDDELPPRQTLVFSATLDKDLQTRLKGKGRRAGGEEDRMAY
LMKCLRFRREPRFLDANPESRLAANLKEGLIECGAMEKDLYLYTVLLLNPGRRTLVFTNSISAVRRITPLLLNLG
LEALPLHSQMAQKARLRSIERFAAPVAKAGSKAPILVATDVAARGLDIHAVDLVIHYHVPRTADAYIHRSGRTAR
AQRTGVSIVLCSPDEVLSTRRLAAKVHVQRGQQEKALAIESLPVNRRVAARLKPRVALAKELADAALAKEKARGD
EAWMRAAAQDLGVEGERGWAAEEGKGGVWVDEGGDGGVEGEAFARVEDEGEYGGE*
Coding >OphauB2|983
ATGGTGTCGTTGAAGAAGCGCAAGCTCGCGGCAGGCTCGGGCCCAGCGCCAAAACGGACAAAAAGACAAGACGAG
AGGAGGAAAGGAGAAGAGCGACCAACGGGCAATGACAAGACGGAGGCGCCGCGGAGGAATACCAAGGCAGCAGCA
TCGAGAGGACGAGTTGTTGACGCGACATCTCTGGCGTGGAAGCCCGTGGGCGAGGAATTCGGCGAGCTGCAAGTC
ATTACAGGGGTGCAAGTCGTCAAGCATGGCGACAAGGTGGAATTCTTGGTAAAGGAGATTGAGGACGGGCAAGAT
GCCACGGCTGAGGAATCTGAGGAGCAAGAGGAGTCTTTTGAAGGGTTTGGCGACGACGTTGTGGAAAGCAAAGAT
GTCGATTCCGGCAAAGCTGGCGGTGTTGAGGCTGGTTTACAAGGCGAGGAGCCTCGTTGCCAGGATTCAGCAAAG
GAGTCGGCGTCGAAAAAGAAGAGCGAGCGGGCGGCGGAGCAGCGCGGCAAGACGAGCAAGAACAAGACGAGCAAG
AAGCAGCCGGCCGTGGGGGACGCGGGCCTCGAAGCCGGCAACTCGTTTGAGCCGCTGGTGGCCATGGCGCAGGAC
AGTGGCGGAGACGTCGACGTGGCGGAGTGGGTGGCGCTGAATCTCTCGACGGGAATGCTGTCGTGCGTGGCAGGG
TTGGGGTTTTCGCAGCCGACGCGGATTCAAAGAATGGCGATTGCGGAGATTCTTGCCGGGCAGGATGTGATTGGA
AAGGCGGAGACGGGTTCGGGCAAGACGCTGGCGTTTGGGATTCCCATTGTGGAAAAGTGGCTGGAAGTAAAGGAG
AGTGCTCAAGACGAGGCCGACGACGACGGACAGCGTTGTATAATGGCAGTGGTTCTCAGTCCAACGAGAGAATTG
GCCAAGCAGCTGGGCGACCACCTCAAGGCCCTCTGTCGACAAGCCGACCCCGCGCCACGCATATGCGTCGTGACG
GGCGGCCTAAGCATCCAGAAACAGCAGCGGCAGCTCGCCCAAGCAAACGTCATTATTGCCACCCCCGGCCGCCTA
TGGGAAGTCATGGACGGCGACGCCCCTCTCCAGGAAGCTCTATCGCGCACGCATTTCCTCGTGATTGACGAGGCG
GACCGGCTCCTCCAAGCAGGACAGTTTGAAGAGGCGCGGAGTATTATTGGCGCGCTGGACCGTTGCGCGCCGGGC
GCAGAGGCGGCGGAGGAGGAGCAGCAGCGTGACGACGAGTTGCCGCCAAGACAGACGCTCGTCTTTTCGGCAACG
CTGGATAAAGACTTGCAGACGAGGCTCAAGGGTAAGGGGAGGCGGGCGGGCGGGGAGGAGGATAGGATGGCGTAT
CTGATGAAGTGTTTGCGGTTTCGGAGAGAGCCGAGGTTTCTGGATGCGAATCCCGAGAGTCGGTTGGCTGCAAAT
CTCAAGGAGGGGCTGATTGAGTGCGGCGCCATGGAAAAGGATCTCTATCTCTACACTGTTCTGCTTCTCAACCCG
GGCCGCCGCACCCTCGTCTTTACAAACTCCATTTCAGCGGTTAGGCGCATAACGCCTCTGCTCCTCAACCTCGGC
CTCGAGGCCTTGCCGCTTCATTCGCAAATGGCACAAAAGGCTCGTCTGCGCTCCATTGAGCGTTTTGCCGCGCCA
GTGGCCAAGGCTGGCAGCAAAGCGCCCATTCTCGTGGCAACAGACGTTGCAGCGCGCGGACTCGATATCCACGCT
GTGGACCTGGTGATTCACTACCACGTGCCGCGCACAGCCGACGCCTATATCCACCGCTCTGGCCGCACGGCACGC
GCGCAACGCACGGGTGTGAGCATTGTGCTCTGCTCGCCCGATGAAGTCTTGTCGACGCGACGGCTAGCGGCAAAA
GTACATGTGCAGCGCGGCCAGCAGGAAAAGGCGCTGGCGATTGAGTCGCTGCCGGTAAATCGACGAGTAGCGGCG
CGGTTGAAGCCGCGAGTGGCGCTGGCCAAGGAGTTGGCGGATGCGGCGCTGGCCAAGGAGAAGGCAAGGGGGGAT
GAGGCGTGGATGCGCGCGGCGGCACAAGACTTGGGTGTGGAGGGGGAGAGGGGGTGGGCGGCGGAAGAGGGAAAA
GGAGGCGTGTGGGTTGACGAGGGCGGAGATGGGGGCGTTGAAGGCGAGGCTTTCGCAAGAGTTGAGGACGAGGGT
GAATATGGGGGTGAGTGA
Transcript >OphauB2|983
ATGGTGTCGTTGAAGAAGCGCAAGCTCGCGGCAGGCTCGGGCCCAGCGCCAAAACGGACAAAAAGACAAGACGAG
AGGAGGAAAGGAGAAGAGCGACCAACGGGCAATGACAAGACGGAGGCGCCGCGGAGGAATACCAAGGCAGCAGCA
TCGAGAGGACGAGTTGTTGACGCGACATCTCTGGCGTGGAAGCCCGTGGGCGAGGAATTCGGCGAGCTGCAAGTC
ATTACAGGGGTGCAAGTCGTCAAGCATGGCGACAAGGTGGAATTCTTGGTAAAGGAGATTGAGGACGGGCAAGAT
GCCACGGCTGAGGAATCTGAGGAGCAAGAGGAGTCTTTTGAAGGGTTTGGCGACGACGTTGTGGAAAGCAAAGAT
GTCGATTCCGGCAAAGCTGGCGGTGTTGAGGCTGGTTTACAAGGCGAGGAGCCTCGTTGCCAGGATTCAGCAAAG
GAGTCGGCGTCGAAAAAGAAGAGCGAGCGGGCGGCGGAGCAGCGCGGCAAGACGAGCAAGAACAAGACGAGCAAG
AAGCAGCCGGCCGTGGGGGACGCGGGCCTCGAAGCCGGCAACTCGTTTGAGCCGCTGGTGGCCATGGCGCAGGAC
AGTGGCGGAGACGTCGACGTGGCGGAGTGGGTGGCGCTGAATCTCTCGACGGGAATGCTGTCGTGCGTGGCAGGG
TTGGGGTTTTCGCAGCCGACGCGGATTCAAAGAATGGCGATTGCGGAGATTCTTGCCGGGCAGGATGTGATTGGA
AAGGCGGAGACGGGTTCGGGCAAGACGCTGGCGTTTGGGATTCCCATTGTGGAAAAGTGGCTGGAAGTAAAGGAG
AGTGCTCAAGACGAGGCCGACGACGACGGACAGCGTTGTATAATGGCAGTGGTTCTCAGTCCAACGAGAGAATTG
GCCAAGCAGCTGGGCGACCACCTCAAGGCCCTCTGTCGACAAGCCGACCCCGCGCCACGCATATGCGTCGTGACG
GGCGGCCTAAGCATCCAGAAACAGCAGCGGCAGCTCGCCCAAGCAAACGTCATTATTGCCACCCCCGGCCGCCTA
TGGGAAGTCATGGACGGCGACGCCCCTCTCCAGGAAGCTCTATCGCGCACGCATTTCCTCGTGATTGACGAGGCG
GACCGGCTCCTCCAAGCAGGACAGTTTGAAGAGGCGCGGAGTATTATTGGCGCGCTGGACCGTTGCGCGCCGGGC
GCAGAGGCGGCGGAGGAGGAGCAGCAGCGTGACGACGAGTTGCCGCCAAGACAGACGCTCGTCTTTTCGGCAACG
CTGGATAAAGACTTGCAGACGAGGCTCAAGGGTAAGGGGAGGCGGGCGGGCGGGGAGGAGGATAGGATGGCGTAT
CTGATGAAGTGTTTGCGGTTTCGGAGAGAGCCGAGGTTTCTGGATGCGAATCCCGAGAGTCGGTTGGCTGCAAAT
CTCAAGGAGGGGCTGATTGAGTGCGGCGCCATGGAAAAGGATCTCTATCTCTACACTGTTCTGCTTCTCAACCCG
GGCCGCCGCACCCTCGTCTTTACAAACTCCATTTCAGCGGTTAGGCGCATAACGCCTCTGCTCCTCAACCTCGGC
CTCGAGGCCTTGCCGCTTCATTCGCAAATGGCACAAAAGGCTCGTCTGCGCTCCATTGAGCGTTTTGCCGCGCCA
GTGGCCAAGGCTGGCAGCAAAGCGCCCATTCTCGTGGCAACAGACGTTGCAGCGCGCGGACTCGATATCCACGCT
GTGGACCTGGTGATTCACTACCACGTGCCGCGCACAGCCGACGCCTATATCCACCGCTCTGGCCGCACGGCACGC
GCGCAACGCACGGGTGTGAGCATTGTGCTCTGCTCGCCCGATGAAGTCTTGTCGACGCGACGGCTAGCGGCAAAA
GTACATGTGCAGCGCGGCCAGCAGGAAAAGGCGCTGGCGATTGAGTCGCTGCCGGTAAATCGACGAGTAGCGGCG
CGGTTGAAGCCGCGAGTGGCGCTGGCCAAGGAGTTGGCGGATGCGGCGCTGGCCAAGGAGAAGGCAAGGGGGGAT
GAGGCGTGGATGCGCGCGGCGGCACAAGACTTGGGTGTGGAGGGGGAGAGGGGGTGGGCGGCGGAAGAGGGAAAA
GGAGGCGTGTGGGTTGACGAGGGCGGAGATGGGGGCGTTGAAGGCGAGGCTTTCGCAAGAGTTGAGGACGAGGGT
GAATATGGGGGTGAGTGA
Gene >OphauB2|983
ATGGTGTCGTTGAAGAAGCGCAAGCTCGCGGCAGGCTCGGGCCCAGCGCCAAAACGGACAAAAAGACAAGACGAG
AGGAGGAAAGGAGAAGAGCGACCAACGGGCAATGACAAGACGGAGGCGCCGCGGAGGAATACCAAGGCAGCAGCA
TCGAGAGGACGAGTTGTTGACGCGACATCTCTGGCGTGGAAGCCCGTGGGCGAGGAATTCGGCGAGCTGCAAGTC
ATTACAGGGGTGCAAGTCGTCAAGCATGGCGACAAGGTGGAATTCTTGGTAAAGGAGATTGAGGACGGGCAAGAT
GCCACGGCTGAGGAATCTGAGGAGCAAGAGGAGTCTTTTGAAGGGTTTGGCGACGACGTTGTGGAAAGCAAAGAT
GTCGATTCCGGCAAAGCTGGCGGTGTTGAGGCTGGTTTACAAGGCGAGGAGCCTCGTTGCCAGGATTCAGCAAAG
GAGTCGGCGTCGAAAAAGAAGAGCGAGCGGGCGGCGGAGCAGCGCGGCAAGACGAGCAAGAACAAGACGAGCAAG
AAGCAGCCGGCCGTGGGGGACGCGGGCCTCGAAGCCGGCAACTCGTTTGAGCCGCTGGTGGCCATGGCGCAGGAC
AGTGGCGGAGACGTCGACGTGGCGGAGTGGGTGGCGCTGAATCTCTCGACGGGAATGCTGTCGTGCGTGGCAGGG
TTGGGGTTTTCGCAGCCGACGCGGATTCAAAGAATGGCGATTGCGGAGATTCTTGCCGGGCAGGATGTGATTGGA
AAGGCGGAGACGGGTTCGGGCAAGACGCTGGCGTTTGGGATTCCCATTGTGGAAAAGTGGCTGGAAGTAAAGGAG
AGTGCTCAAGACGAGGCCGACGACGACGGACAGCGTTGTATAATGGCAGTGGTTCTCAGTCCAACGAGAGAATTG
GCCAAGCAGCTGGGCGACCACCTCAAGGCCCTCTGTCGACAAGCCGACCCCGCGCCACGCATATGCGTCGTGACG
GGCGGCCTAAGCATCCAGAAACAGCAGCGGCAGCTCGCCCAAGCAAACGTCATTATTGCCACCCCCGGCCGCCTA
TGGGAAGTCATGGACGGCGACGCCCCTCTCCAGGAAGCTCTATCGCGCACGCATTTCCTCGTGATTGACGAGGCG
GACCGGCTCCTCCAAGCAGGACAGTTTGAAGAGGCGCGGAGTATTATTGGCGCGCTGGACCGTTGCGCGCCGGGC
GCAGAGGCGGCGGAGGAGGAGCAGCAGCGTGACGACGAGTTGCCGCCAAGACAGACGCTCGTCTTTTCGGCAACG
CTGGATAAAGACTTGCAGACGAGGCTCAAGGGTAAGGGGAGGCGGGCGGGCGGGGAGGAGGATAGGATGGCGTAT
CTGATGAAGTGTTTGCGGTTTCGGAGAGAGCCGAGGTTTCTGGATGCGAATCCCGAGAGTCGGTTGGCTGCAAAT
CTCAAGGAGGGGCTGATTGAGTGCGGCGCCATGGAAAAGGTGAGGGTTTTTTTTTTCTTTGTCCTCTTGACTACT
GCTACAACCTCTTGTCTACTGCTACAAGCTCTCGTCAAGTAAATTCGGGCTAACAAGGTGCCAACAAAAAAAAGG
ATCTCTATCTCTACACTGTTCTGCTTCTCAACCCGGGCCGCCGCACCCTCGTCTTTACAAACTCCATTTCAGCGG
TTAGGCGCATAACGCCTCTGCTCCTCAACCTCGGCCTCGAGGCCTTGCCGCTTCATTCGCAAATGGCACAAAAGG
CTCGTCTGCGCTCCATTGAGCGTTTTGCCGCGCCAGTGGCCAAGGCTGGCAGCAAAGCGCCCATTCTCGTGGCAA
CAGACGTTGCAGCGCGCGGACTCGATATCCACGCTGTGGACCTGGTGATTCACTACCACGTGCCGCGCACAGCCG
ACGCCTATATCCACCGCTCTGGCCGCACGGCACGCGCGCAACGCACGGGTGTGAGCATTGTGCTCTGCTCGCCCG
ATGAAGTCTTGTCGACGCGACGGCTAGCGGCAAAAGTACATGTGCAGCGCGGCCAGCAGGAAAAGGCGCTGGCGA
TTGAGTCGCTGCCGGTAAATCGACGAGTAGCGGCGCGGTTGAAGCCGCGAGTGGCGCTGGCCAAGGAGTTGGCGG
ATGCGGCGCTGGCCAAGGAGAAGGCAAGGGGGGATGAGGCGTGGATGCGCGCGGCGGCACAAGACTTGGGTGTGG
AGTATGATGGGGATGAATTTGAGGAGGGCAAAGGGTGTAGAGGGGGGAGAGGGGGTGGGCGGCGGAAGAGGGAAA
AGGAGGCGTGTGGGTTGACGAGGGCGGAGATGGGGGCGTTGAAGGCGAGGCTTTCGCAAGAGTTGAGGACGAGGG
TGAATATGGGGGTGAGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail