Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|979
Gene name
LocationContig_120:62730..63944
Strand+
Gene length (bp)1214
Transcript length (bp)1125
Coding sequence length (bp)1125
Protein length (aa) 375

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 1.6E-21 130 292

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 77 290 3.0E-22
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 93 306 1.0E-21
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 72 295 2.0E-21
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 77 278 1.0E-19
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 38 304 3.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9ZU49|LPP1_ARATH Lipid phosphate phosphatase 1 OS=Arabidopsis thaliana GN=LPP1 PE=2 SV=2 77 290 3.0E-22
sp|Q6GQ62|PLPP5_XENLA Phospholipid phosphatase 5 OS=Xenopus laevis GN=plpp5 PE=2 SV=1 93 306 1.0E-21
sp|Q9XI60|LPP2_ARATH Lipid phosphate phosphatase 2 OS=Arabidopsis thaliana GN=LPP2 PE=2 SV=1 72 295 2.0E-21
sp|Q8LFD1|LPP3_ARATH Putative lipid phosphate phosphatase 3, chloroplastic OS=Arabidopsis thaliana GN=LPP3 PE=2 SV=1 77 278 1.0E-19
sp|Q86AF0|Y7151_DICDI PA-phosphatase related-family protein DDB_G0271516 OS=Dictyostelium discoideum GN=DDB_G0271516 PE=3 SV=1 38 304 3.0E-19
sp|Q8MXL9|Y5547_DICDI PA-phosphatase related-family protein DDB_G0275547 OS=Dictyostelium discoideum GN=DDB_G0275547 PE=3 SV=2 30 304 4.0E-18
sp|Q8NEB5|PLPP5_HUMAN Phospholipid phosphatase 5 OS=Homo sapiens GN=PLPP5 PE=1 SV=2 81 306 2.0E-17
sp|Q3UMZ3|PLPP5_MOUSE Phospholipid phosphatase 5 OS=Mus musculus GN=Plpp5 PE=2 SV=1 93 307 2.0E-16
sp|Q0WNG6|LPP4_ARATH Probable lipid phosphate phosphatase 4 OS=Arabidopsis thaliana GN=LPP4 PE=2 SV=1 27 295 3.0E-16
sp|Q05521|DPP1_YEAST Diacylglycerol pyrophosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPP1 PE=1 SV=1 137 326 9.0E-16
sp|Q54PR7|Y4367_DICDI PA-phosphatase related-family protein DDB_G0284367 OS=Dictyostelium discoideum GN=DDB_G0284367 PE=3 SV=1 81 308 1.0E-13
sp|Q0VBU9|PLPP4_MOUSE Phospholipid phosphatase 4 OS=Mus musculus GN=Plpp4 PE=2 SV=1 93 290 2.0E-12
sp|Q5VZY2|PLPP4_HUMAN Phospholipid phosphatase 4 OS=Homo sapiens GN=PLPP4 PE=1 SV=2 93 290 2.0E-12
sp|Q04396|LPP1_YEAST Lipid phosphate phosphatase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LPP1 PE=1 SV=1 144 291 3.0E-12
sp|Q9UUA6|DPP1_SCHPO Probable diacylglycerol pyrophosphate phosphatase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpp1 PE=3 SV=1 93 287 9.0E-12
sp|Q9V576|WUN_DROME Putative phosphatidate phosphatase OS=Drosophila melanogaster GN=wun PE=1 SV=2 117 283 5.0E-10
sp|Q9DAX2|PLPP2_MOUSE Phospholipid phosphatase 2 OS=Mus musculus GN=Plpp2 PE=1 SV=1 100 288 6.0E-07
sp|Q61469|PLPP1_MOUSE Phospholipid phosphatase 1 OS=Mus musculus GN=Plpp1 PE=1 SV=1 84 316 3.0E-06
sp|Q8K593|PLPP2_RAT Phospholipid phosphatase 2 OS=Rattus norvegicus GN=Plpp2 PE=2 SV=1 100 282 5.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 35 0.5

Transmembrane Domains

Domain # Start End Length
1 36 58 22
2 92 114 22
3 127 144 17
4 204 226 22
5 239 261 22
6 271 290 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|979
MAPGSSLPPGGDAAHNGPVPASLPWVQVVRNFVVDWLVLNWVDVVSMMALGGVTFGVYHSPVFVTRTFPISFNGT
SGDIVYPQLAYPDRGWIIPSWLAGIISIGAPIVVYLAALFKIQCLWDATASIMGSIASVLLASLFQVTIKQLVGG
FRPYFLTVCMPDAHRLRHDASLNRTGLNAVGYHQLMYSTDVCTQPDGRKLKNAITSFPSGHSTAAFAGFGFLFLW
LNAKLKVWADHRPAFWKLALTMVPLLTATVFACILTVDAAHNWYDVLAGSVIGGLAALAGYRWSYAAVWDWRWNH
VPLRRREPFDYEAVHHDGRLTLGRAAGWGGGGAGRRDSATSSSALVSFAAPLGGQDGGRQRRRAGVGGRAGEAA*
Coding >OphauB2|979
ATGGCTCCAGGCTCGTCTTTGCCGCCAGGTGGCGACGCGGCGCACAATGGGCCAGTGCCGGCGTCGCTGCCGTGG
GTGCAAGTGGTGCGCAATTTTGTTGTTGACTGGCTGGTGCTCAACTGGGTGGATGTGGTGAGCATGATGGCGCTG
GGCGGCGTCACGTTTGGCGTCTACCACTCTCCAGTCTTTGTGACGCGGACCTTTCCGATTTCCTTTAATGGCACC
TCTGGCGACATTGTCTACCCCCAACTGGCGTACCCGGACCGTGGATGGATTATCCCCTCGTGGCTGGCAGGCATC
ATATCGATAGGAGCGCCCATTGTGGTCTACCTAGCCGCGCTGTTCAAGATTCAATGTCTCTGGGACGCCACAGCA
TCCATCATGGGCTCCATTGCTTCTGTCCTGCTCGCCTCCCTCTTCCAAGTAACCATTAAGCAACTGGTAGGCGGC
TTCCGCCCCTACTTTTTAACCGTCTGCATGCCCGACGCGCACCGCCTCCGCCACGACGCCTCGCTCAACCGCACC
GGGCTCAACGCCGTGGGCTACCACCAACTCATGTACTCAACCGACGTGTGCACGCAGCCCGACGGCCGCAAACTC
AAGAATGCAATCACGTCGTTTCCCAGCGGGCACTCGACTGCCGCGTTTGCCGGCTTTGGCTTCCTCTTTCTCTGG
CTCAATGCCAAGCTCAAGGTGTGGGCCGACCACCGCCCTGCGTTTTGGAAGCTGGCGCTCACCATGGTGCCTCTC
CTCACGGCAACAGTGTTTGCCTGCATCCTGACGGTGGACGCGGCTCATAATTGGTATGATGTCCTGGCGGGGTCC
GTCATTGGCGGCCTGGCGGCGCTGGCTGGATACCGCTGGTCGTATGCTGCTGTCTGGGACTGGAGATGGAACCAC
GTACCGCTGCGGCGCCGCGAGCCCTTTGATTACGAGGCGGTGCATCATGATGGCCGCTTGACGCTGGGGCGGGCT
GCTGGTTGGGGGGGGGGAGGGGCGGGCAGGCGGGACAGCGCGACTAGCAGTTCTGCGTTGGTGTCGTTTGCGGCG
CCCCTTGGTGGACAAGATGGGGGGAGGCAGAGACGGCGGGCTGGTGTAGGAGGGAGGGCGGGTGAGGCTGCGTGA
Transcript >OphauB2|979
ATGGCTCCAGGCTCGTCTTTGCCGCCAGGTGGCGACGCGGCGCACAATGGGCCAGTGCCGGCGTCGCTGCCGTGG
GTGCAAGTGGTGCGCAATTTTGTTGTTGACTGGCTGGTGCTCAACTGGGTGGATGTGGTGAGCATGATGGCGCTG
GGCGGCGTCACGTTTGGCGTCTACCACTCTCCAGTCTTTGTGACGCGGACCTTTCCGATTTCCTTTAATGGCACC
TCTGGCGACATTGTCTACCCCCAACTGGCGTACCCGGACCGTGGATGGATTATCCCCTCGTGGCTGGCAGGCATC
ATATCGATAGGAGCGCCCATTGTGGTCTACCTAGCCGCGCTGTTCAAGATTCAATGTCTCTGGGACGCCACAGCA
TCCATCATGGGCTCCATTGCTTCTGTCCTGCTCGCCTCCCTCTTCCAAGTAACCATTAAGCAACTGGTAGGCGGC
TTCCGCCCCTACTTTTTAACCGTCTGCATGCCCGACGCGCACCGCCTCCGCCACGACGCCTCGCTCAACCGCACC
GGGCTCAACGCCGTGGGCTACCACCAACTCATGTACTCAACCGACGTGTGCACGCAGCCCGACGGCCGCAAACTC
AAGAATGCAATCACGTCGTTTCCCAGCGGGCACTCGACTGCCGCGTTTGCCGGCTTTGGCTTCCTCTTTCTCTGG
CTCAATGCCAAGCTCAAGGTGTGGGCCGACCACCGCCCTGCGTTTTGGAAGCTGGCGCTCACCATGGTGCCTCTC
CTCACGGCAACAGTGTTTGCCTGCATCCTGACGGTGGACGCGGCTCATAATTGGTATGATGTCCTGGCGGGGTCC
GTCATTGGCGGCCTGGCGGCGCTGGCTGGATACCGCTGGTCGTATGCTGCTGTCTGGGACTGGAGATGGAACCAC
GTACCGCTGCGGCGCCGCGAGCCCTTTGATTACGAGGCGGTGCATCATGATGGCCGCTTGACGCTGGGGCGGGCT
GCTGGTTGGGGGGGGGGAGGGGCGGGCAGGCGGGACAGCGCGACTAGCAGTTCTGCGTTGGTGTCGTTTGCGGCG
CCCCTTGGTGGACAAGATGGGGGGAGGCAGAGACGGCGGGCTGGTGTAGGAGGGAGGGCGGGTGAGGCTGCGTGA
Gene >OphauB2|979
ATGGCTCCAGGCTCGTCTTTGCCGCCAGGTGGCGACGCGGCGCACAATGGGCCAGTGCCGGCGTCGCTGCCGTGG
GTGCAAGTGGTGCGCAATTTTGTTGTTGACTGGCTGGTGCTCAACTGGGTGGATGTGGTGAGCATGATGGCGCTG
GGCGGCGTCACGTTTGGCGTGGGTTGACACTTTTTCTTTTTCTTTTTTTTTTTTTTTGTTCGCTGATGAGGACAA
GGGGGATTTTTTTTTTTTTAACTCGATGCTAGGTCTACCACTCTCCAGTCTTTGTGACGCGGACCTTTCCGATTT
CCTTTAATGGCACCTCTGGCGACATTGTCTACCCCCAACTGGCGTACCCGGACCGTGGATGGATTATCCCCTCGT
GGCTGGCAGGCATCATATCGATAGGAGCGCCCATTGTGGTCTACCTAGCCGCGCTGTTCAAGATTCAATGTCTCT
GGGACGCCACAGCATCCATCATGGGCTCCATTGCTTCTGTCCTGCTCGCCTCCCTCTTCCAAGTAACCATTAAGC
AACTGGTAGGCGGCTTCCGCCCCTACTTTTTAACCGTCTGCATGCCCGACGCGCACCGCCTCCGCCACGACGCCT
CGCTCAACCGCACCGGGCTCAACGCCGTGGGCTACCACCAACTCATGTACTCAACCGACGTGTGCACGCAGCCCG
ACGGCCGCAAACTCAAGAATGCAATCACGTCGTTTCCCAGCGGGCACTCGACTGCCGCGTTTGCCGGCTTTGGCT
TCCTCTTTCTCTGGCTCAATGCCAAGCTCAAGGTGTGGGCCGACCACCGCCCTGCGTTTTGGAAGCTGGCGCTCA
CCATGGTGCCTCTCCTCACGGCAACAGTGTTTGCCTGCATCCTGACGGTGGACGCGGCTCATAATTGGTATGATG
TCCTGGCGGGGTCCGTCATTGGCGGCCTGGCGGCGCTGGCTGGATACCGCTGGTCGTATGCTGCTGTCTGGGACT
GGAGATGGAACCACGTACCGCTGCGGCGCCGCGAGCCCTTTGATTACGAGGCGGTGCATCATGATGGCCGCTTGA
CGCTGGGGCGGGCTGCTGGTTGGGGGGGGGGAGGGGCGGGCAGGCGGGACAGCGCGACTAGCAGTTCTGCGTTGG
TGTCGTTTGCGGCGCCCCTTGGTGGACAAGATGGGGGGAGGCAGAGACGGCGGGCTGGTGTAGGAGGGAGGGCGG
GTGAGGCTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail