Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|974
Gene name
LocationContig_120:48968..49605
Strand+
Gene length (bp)637
Transcript length (bp)585
Coding sequence length (bp)585
Protein length (aa) 195

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13086 AAA_11 AAA domain 4.3E-07 102 189

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P2E3|ZNFX1_HUMAN NFX1-type zinc finger-containing protein 1 OS=Homo sapiens GN=ZNFX1 PE=2 SV=2 89 190 6.0E-10
sp|Q8R151|ZNFX1_MOUSE NFX1-type zinc finger-containing protein 1 OS=Mus musculus GN=Znfx1 PE=1 SV=3 89 190 9.0E-10

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0003824 catalytic activity No
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 57 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|974
MCKIDAINARHELDASLQDLRKPVTYKDILSMLEFSGEDEFYWESFQVPEQEAGFQVAARNNAPLTPSLVYQMWI
QGKRRSPIDCNSCVWALPMETRFQLHDKWSKKVDKEKMAHYAELAEKHAQLSKQINNFYEDTNRNVLRSKRIIGC
TTTAASMYQSIIASASPDIVIVEEAGEILESHLFAALSQSIVIH*
Coding >OphauB2|974
ATGTGCAAAATTGACGCTATTAACGCCAGACATGAACTGGATGCGTCATTGCAAGATTTGCGGAAGCCTGTCACA
TACAAGGACATACTTTCAATGCTAGAGTTCAGTGGCGAAGATGAATTCTATTGGGAATCATTCCAGGTTCCTGAG
CAAGAGGCCGGCTTTCAAGTTGCTGCAAGAAACAACGCTCCGCTCACTCCATCTCTTGTCTACCAGATGTGGATC
CAGGGCAAACGCAGGAGCCCCATAGACTGCAACAGTTGCGTTTGGGCGCTGCCCATGGAGACCAGGTTTCAGCTC
CATGATAAATGGTCCAAGAAAGTTGACAAGGAGAAGATGGCCCATTACGCTGAGCTTGCTGAGAAGCATGCTCAA
CTTAGCAAGCAAATCAACAACTTTTATGAGGATACAAATCGCAATGTGCTGAGAAGCAAACGAATCATTGGCTGT
ACAACGACGGCAGCATCCATGTATCAGTCAATAATTGCTTCTGCGTCACCAGATATTGTCATCGTGGAAGAGGCA
GGAGAAATCCTCGAGTCTCATCTGTTTGCAGCTCTCAGCCAATCAATAGTTATCCATTGA
Transcript >OphauB2|974
ATGTGCAAAATTGACGCTATTAACGCCAGACATGAACTGGATGCGTCATTGCAAGATTTGCGGAAGCCTGTCACA
TACAAGGACATACTTTCAATGCTAGAGTTCAGTGGCGAAGATGAATTCTATTGGGAATCATTCCAGGTTCCTGAG
CAAGAGGCCGGCTTTCAAGTTGCTGCAAGAAACAACGCTCCGCTCACTCCATCTCTTGTCTACCAGATGTGGATC
CAGGGCAAACGCAGGAGCCCCATAGACTGCAACAGTTGCGTTTGGGCGCTGCCCATGGAGACCAGGTTTCAGCTC
CATGATAAATGGTCCAAGAAAGTTGACAAGGAGAAGATGGCCCATTACGCTGAGCTTGCTGAGAAGCATGCTCAA
CTTAGCAAGCAAATCAACAACTTTTATGAGGATACAAATCGCAATGTGCTGAGAAGCAAACGAATCATTGGCTGT
ACAACGACGGCAGCATCCATGTATCAGTCAATAATTGCTTCTGCGTCACCAGATATTGTCATCGTGGAAGAGGCA
GGAGAAATCCTCGAGTCTCATCTGTTTGCAGCTCTCAGCCAATCAATAGTTATCCATTGA
Gene >OphauB2|974
ATGTGCAAAATTGACGCTATTAACGCCAGACATGAACTGGATGCGTCATTGCAAGATTTGCGGAAGCCTGTCACA
TACAAGGACATACTTTCAATGCTAGAGTTCAGTGGCGAAGATGAATTCTATTGGGAATCATTCCAGGTTCCTGAG
CAAGAGGCCGGCTTTCAAGTTGCTGCAAGAAACAACGCTCCGCTCACTCCATCTCTTGTCTACCAGATGTGGATC
CAGGGCAAACGCAGGAGCCCCATAGACTGCAACAGTTGCGTTTGGGCGCTGCCCATGGAGACCAGGTTTCAGCTC
CATGATAAATGGTCCAAGAAAGTTGACAAGGAGAAGATGGCCCATTACGCTGAGCTTGCTGAGAAGCATGCTCAA
CTTAGCAAGCAAATCAACAACTTTTATGAGGATACAAATCGCAATGTGCTGAGAAGCAAACGAATCATTGGCTGT
ACAACGACGGCAGCATCCATGTATCAGTCAATAATTGCTTCTGCGTCACCAGATATTGTCATCGTGGAAGAGGCA
GGAGAAATCCTCGAGTCTCATCTGTTTGCAGCTCTCAGCCAGTCTGTGAAACAGCTCATCCTTATTGGCGACCAC
AAGCAGCTCCGGCCAAAGATCAATAGTTATCCATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail