Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|970
Gene name
LocationContig_120:38440..44227
Strand-
Gene length (bp)5787
Transcript length (bp)5457
Coding sequence length (bp)5457
Protein length (aa) 1819

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00176 SNF2-rel_dom SNF2-related domain 1.0E-64 980 1265
PF13892 DBINO DNA-binding domain 3.2E-48 718 849
PF00271 Helicase_C Helicase conserved C-terminal domain 3.2E-20 1545 1657
PF04851 ResIII Type III restriction enzyme, res subunit 4.4E-07 962 1130

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 69 1817 0.0E+00
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 108 1818 0.0E+00
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 155 1818 0.0E+00
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 392 1818 0.0E+00
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 179 1817 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IL82|INO80_GIBZE Putative DNA helicase INO80 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=INO80 PE=3 SV=1 69 1817 0.0E+00
sp|Q872I5|INO80_NEUCR Putative DNA helicase ino80 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf2-1 PE=3 SV=3 108 1818 0.0E+00
sp|A4R227|INO80_MAGO7 Putative DNA helicase INO80 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=INO80 PE=3 SV=1 155 1818 0.0E+00
sp|A7EQA8|INO80_SCLS1 Putative DNA helicase INO80 OS=Sclerotinia sclerotiorum (strain ATCC 18683 / 1980 / Ss-1) GN=INO80 PE=3 SV=1 392 1818 0.0E+00
sp|Q1DUF9|INO80_COCIM Putative DNA helicase INO80 OS=Coccidioides immitis (strain RS) GN=INO80 PE=3 SV=1 179 1817 0.0E+00
sp|A2R9H9|INO80_ASPNC Putative DNA helicase ino80 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ino80 PE=3 SV=1 181 1814 0.0E+00
sp|Q4WTV7|INO80_ASPFU Putative DNA helicase ino80 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=ino80 PE=3 SV=1 183 1814 0.0E+00
sp|A1CZE5|INO80_NEOFI Putative DNA helicase ino80 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=ino80 PE=3 SV=1 183 1814 0.0E+00
sp|A1C9W6|INO80_ASPCL Putative DNA helicase ino80 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ino80 PE=3 SV=1 411 1814 0.0E+00
sp|Q0CA78|INO80_ASPTN Putative DNA helicase ino80 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=ino80 PE=3 SV=1 408 1814 0.0E+00
sp|Q0UG82|INO80_PHANO Putative DNA helicase INO80 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=INO80 PE=3 SV=2 57 1816 0.0E+00
sp|Q2UTQ9|INO80_ASPOR Putative DNA helicase ino80 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=ino80 PE=3 SV=1 379 1765 0.0E+00
sp|Q6BGY8|INO80_DEBHA Putative DNA helicase INO80 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=INO80 PE=3 SV=2 653 1785 0.0E+00
sp|A5E0W5|INO80_LODEL Putative DNA helicase ino80 OS=Lodderomyces elongisporus (strain ATCC 11503 / CBS 2605 / JCM 1781 / NBRC 1676 / NRRL YB-4239) GN=INO80 PE=3 SV=1 709 1785 0.0E+00
sp|Q59KI4|INO80_CANAL Putative DNA helicase INO80 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=INO80 PE=3 SV=1 717 1692 0.0E+00
sp|Q6CNY4|INO80_KLULA Putative DNA helicase INO80 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=INO80 PE=3 SV=1 709 1696 0.0E+00
sp|A7TJI3|INO80_VANPO Putative DNA helicase INO80 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=INO80 PE=3 SV=1 717 1700 0.0E+00
sp|O14148|INO80_SCHPO Putative DNA helicase ino80 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ino80 PE=1 SV=4 673 1721 0.0E+00
sp|Q74Z27|INO80_ASHGO Putative DNA helicase INO80 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=INO80 PE=3 SV=2 709 1694 0.0E+00
sp|P53115|INO80_YEAST Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=INO80 PE=1 SV=1 709 1694 0.0E+00
sp|A6ZU34|INO80_YEAS7 Putative DNA helicase INO80 OS=Saccharomyces cerevisiae (strain YJM789) GN=INO80 PE=3 SV=1 709 1694 0.0E+00
sp|Q6FV37|INO80_CANGA Putative DNA helicase INO80 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=INO80 PE=3 SV=1 594 1694 0.0E+00
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 191 1285 0.0E+00
sp|P0CO16|INO80_CRYNJ Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=INO80 PE=3 SV=1 695 1773 0.0E+00
sp|P0CO17|INO80_CRYNB Putative DNA helicase INO80 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=INO80 PE=3 SV=1 695 1773 0.0E+00
sp|Q6ZPV2|INO80_MOUSE DNA helicase INO80 OS=Mus musculus GN=Ino80 PE=1 SV=2 709 1725 0.0E+00
sp|Q9ULG1|INO80_HUMAN DNA helicase INO80 OS=Homo sapiens GN=INO80 PE=1 SV=2 709 1725 0.0E+00
sp|Q8RXS6|INO80_ARATH DNA helicase INO80 OS=Arabidopsis thaliana GN=INO80 PE=2 SV=2 725 1762 0.0E+00
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 721 1384 0.0E+00
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 724 1378 2.0E-165
sp|Q5BAZ5|INO80_EMENI Putative DNA helicase ino80 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ino80 PE=3 SV=1 1345 1814 6.0E-149
sp|Q59U81|SWR1_CANAL Helicase SWR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SWR1 PE=3 SV=1 935 1704 4.0E-144
sp|Q4P328|SWR1_USTMA Helicase SWR1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=SWR1 PE=3 SV=1 953 1705 4.0E-136
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 951 1321 1.0E-95
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 859 1274 6.0E-94
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 893 1274 1.0E-90
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 956 1274 1.0E-89
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 952 1309 7.0E-88
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 944 1275 4.0E-86
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 944 1275 6.0E-86
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 933 1274 1.0E-85
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 944 1340 8.0E-84
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 953 1274 1.0E-83
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 956 1316 2.0E-82
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 953 1274 7.0E-82
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 920 1275 3.0E-81
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 956 1274 9.0E-81
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 949 1275 4.0E-80
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 949 1275 4.0E-80
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 951 1274 1.0E-79
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 956 1275 2.0E-79
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 963 1275 2.0E-73
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 963 1275 5.0E-73
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 946 1277 3.0E-72
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 962 1275 6.0E-72
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 953 1277 1.0E-71
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 962 1275 1.0E-71
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 952 1269 3.0E-71
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 912 1276 3.0E-71
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 958 1269 5.0E-71
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 953 1277 1.0E-70
sp|Q4PGL2|INO80_USTMA Putative DNA helicase INO80 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=INO80 PE=3 SV=1 1500 1732 4.0E-70
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 954 1265 6.0E-70
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 958 1309 7.0E-70
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 958 1309 8.0E-70
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 954 1276 1.0E-69
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 958 1309 1.0E-69
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 958 1309 1.0E-69
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 947 1269 3.0E-69
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 962 1275 1.0E-68
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 951 1309 1.0E-68
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 951 1309 2.0E-68
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 950 1269 2.0E-68
sp|Q9VDY1|INO80_DROME Putative DNA helicase Ino80 OS=Drosophila melanogaster GN=Ino80 PE=1 SV=2 1528 1751 6.0E-68
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 954 1275 3.0E-67
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 954 1269 1.0E-65
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 795 1266 2.0E-65
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 913 1275 2.0E-65
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 954 1269 2.0E-65
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 950 1221 3.0E-64
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 954 1264 4.0E-64
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 958 1273 9.0E-63
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 953 1264 1.0E-61
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 947 1272 3.0E-60
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 960 1269 4.0E-60
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 962 1269 8.0E-60
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 949 1264 1.0E-58
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 949 1264 1.0E-58
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 949 1264 1.0E-58
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 920 1264 2.0E-58
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 954 1266 6.0E-58
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 954 1264 6.0E-58
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 954 1266 1.0E-57
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 806 1239 3.0E-57
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 954 1266 4.0E-57
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 955 1270 6.0E-57
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 944 1273 8.0E-57
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 806 1227 3.0E-56
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 954 1266 6.0E-56
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 955 1273 2.0E-55
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 955 1273 3.0E-55
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 950 1277 7.0E-55
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 954 1265 1.0E-54
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 907 1265 3.0E-54
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 955 1294 4.0E-54
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 952 1277 5.0E-54
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 955 1294 5.0E-54
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 955 1330 7.0E-54
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 955 1294 8.0E-54
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 960 1309 1.0E-53
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 960 1309 1.0E-53
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 951 1277 2.0E-53
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 952 1277 2.0E-53
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 962 1338 2.0E-53
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 955 1318 3.0E-53
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 951 1286 4.0E-53
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 947 1264 5.0E-53
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 956 1269 5.0E-53
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 954 1269 1.0E-52
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 960 1309 1.0E-52
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 960 1310 1.0E-52
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 960 1310 2.0E-52
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 952 1277 2.0E-52
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 954 1267 4.0E-52
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 960 1310 5.0E-52
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 959 1277 5.0E-52
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 954 1265 5.0E-52
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 961 1277 1.0E-51
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 962 1269 4.0E-51
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 962 1269 5.0E-51
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 962 1269 5.0E-51
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 962 1269 5.0E-51
sp|Q24368|ISWI_DROME Chromatin-remodeling complex ATPase chain Iswi OS=Drosophila melanogaster GN=Iswi PE=1 SV=1 1539 1783 2.0E-50
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 962 1269 9.0E-50
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 960 1265 2.0E-49
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 962 1269 2.0E-49
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 954 1287 2.0E-49
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 962 1269 2.0E-49
sp|Q5A310|ISW2_CANAL ISWI chromatin-remodeling complex ATPase ISW2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ISW2 PE=2 SV=1 1537 1695 5.0E-48
sp|Q9NRZ9|HELLS_HUMAN Lymphoid-specific helicase OS=Homo sapiens GN=HELLS PE=1 SV=1 1499 1702 5.0E-48
sp|Q6ZRS2|SRCAP_HUMAN Helicase SRCAP OS=Homo sapiens GN=SRCAP PE=1 SV=3 1534 1768 7.0E-48
sp|Q91ZW3|SMCA5_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Mus musculus GN=Smarca5 PE=1 SV=1 1539 1770 7.0E-48
sp|O60264|SMCA5_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 5 OS=Homo sapiens GN=SMARCA5 PE=1 SV=1 1539 1770 7.0E-48
sp|Q08773|ISW2_YEAST ISWI chromatin-remodeling complex ATPase ISW2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW2 PE=1 SV=1 1537 1767 8.0E-48
sp|Q759G7|SWR1_ASHGO Helicase SWR1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=SWR1 PE=3 SV=2 1531 1730 1.0E-47
sp|P0CO18|SWR1_CRYNJ Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=SWR1 PE=3 SV=1 1531 1704 3.0E-47
sp|P0CO19|SWR1_CRYNB Helicase SWR1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=SWR1 PE=3 SV=1 1531 1704 3.0E-47
sp|Q9NDJ2|DOM_DROME Helicase domino OS=Drosophila melanogaster GN=dom PE=1 SV=2 1542 1762 5.0E-47
sp|P41877|ISW1_CAEEL Chromatin-remodeling complex ATPase chain isw-1 OS=Caenorhabditis elegans GN=isw-1 PE=1 SV=2 1537 1698 6.0E-47
sp|Q7X9V2|PIE1_ARATH Protein PHOTOPERIOD-INDEPENDENT EARLY FLOWERING 1 OS=Arabidopsis thaliana GN=PIE1 PE=1 SV=1 1531 1707 2.0E-46
sp|P28370|SMCA1_HUMAN Probable global transcription activator SNF2L1 OS=Homo sapiens GN=SMARCA1 PE=1 SV=2 1537 1770 2.0E-46
sp|Q6CJ38|SWR1_KLULA Helicase SWR1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=SWR1 PE=3 SV=1 1531 1701 3.0E-46
sp|Q6FK48|SWR1_CANGA Helicase SWR1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SWR1 PE=3 SV=1 1531 1701 3.0E-46
sp|Q6BKC2|SWR1_DEBHA Helicase SWR1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SWR1 PE=3 SV=2 1531 1787 5.0E-46
sp|Q60848|HELLS_MOUSE Lymphocyte-specific helicase OS=Mus musculus GN=Hells PE=1 SV=2 1503 1742 5.0E-46
sp|Q05471|SWR1_YEAST Helicase SWR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SWR1 PE=1 SV=1 1531 1739 8.0E-46
sp|Q4IAK7|SWR1_GIBZE Helicase SWR1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=SWR1 PE=3 SV=1 1519 1792 9.0E-46
sp|Q6PGB8|SMCA1_MOUSE Probable global transcription activator SNF2L1 OS=Mus musculus GN=Smarca1 PE=1 SV=1 1537 1768 1.0E-45
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 963 1267 2.0E-45
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 963 1271 2.0E-45
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 954 1265 2.0E-45
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 956 1265 2.0E-45
sp|Q7S133|SWR1_NEUCR Helicase swr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=crf1-1 PE=3 SV=1 1531 1704 4.0E-45
sp|E9PZM4|CHD2_MOUSE Chromodomain-helicase-DNA-binding protein 2 OS=Mus musculus GN=Chd2 PE=1 SV=1 1522 1709 6.0E-45
sp|Q9VL72|SMRCD_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Drosophila melanogaster GN=Etl1 PE=1 SV=1 1525 1689 6.0E-45
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 954 1269 9.0E-45
sp|O94421|SNF22_SCHPO SWI/SNF chromatin-remodeling complex subunit snf22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf22 PE=1 SV=2 1543 1762 1.0E-44
sp|O13682|SWR1_SCHPO Helicase swr1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swr1 PE=3 SV=1 1531 1701 2.0E-44
sp|P38144|ISW1_YEAST ISWI chromatin-remodeling complex ATPase ISW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ISW1 PE=1 SV=2 1559 1699 3.0E-44
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 917 1265 3.0E-44
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2 OS=Homo sapiens GN=CHD2 PE=1 SV=2 1519 1709 5.0E-44
sp|Q7KU24|CHD1_DROME Chromodomain-helicase-DNA-binding protein 1 OS=Drosophila melanogaster GN=Chd1 PE=1 SV=1 1535 1711 7.0E-44
sp|Q9UTN6|SNF21_SCHPO Chromatin structure-remodeling complex subunit snf21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=snf21 PE=1 SV=1 1543 1710 8.0E-44
sp|Q6CA87|SWR1_YARLI Helicase SWR1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SWR1 PE=3 SV=1 1531 1701 9.0E-44
sp|Q4WAS9|SWR1_ASPFU Helicase swr1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=swr1 PE=3 SV=1 1521 1701 3.0E-43
sp|C0H4W3|HEPF1_PLAF7 Probable ATP-dependent helicase PF08_0048 OS=Plasmodium falciparum (isolate 3D7) GN=PF08_0048 PE=3 SV=1 1531 1695 4.0E-43
sp|Q5ARK3|SWR1_EMENI Helicase swr1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=swr1 PE=3 SV=2 1521 1777 5.0E-43
sp|F4J9M5|CHR12_ARATH Probable ATP-dependent DNA helicase CHR12 OS=Arabidopsis thaliana GN=CHR12 PE=2 SV=1 1539 1695 1.0E-42
sp|P51532|SMCA4_HUMAN Transcription activator BRG1 OS=Homo sapiens GN=SMARCA4 PE=1 SV=2 1523 1725 1.0E-42
sp|F4K128|CHR23_ARATH Probable ATP-dependent DNA helicase CHR23 OS=Arabidopsis thaliana GN=CHR23 PE=2 SV=1 1539 1695 1.0E-42
sp|A7Z019|SMCA4_BOVIN Transcription activator BRG1 OS=Bos taurus GN=SMARCA4 PE=2 SV=1 1523 1695 2.0E-42
sp|Q3TKT4|SMCA4_MOUSE Transcription activator BRG1 OS=Mus musculus GN=Smarca4 PE=1 SV=1 1523 1695 2.0E-42
sp|Q8K1P7|SMCA4_RAT Transcription activator BRG1 OS=Rattus norvegicus GN=Smarca4 PE=1 SV=1 1523 1695 2.0E-42
sp|P32597|STH1_YEAST Nuclear protein STH1/NPS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STH1 PE=1 SV=1 1543 1695 2.0E-42
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 956 1264 2.0E-42
sp|Q9NEL2|SSL1_CAEEL Helicase ssl-1 OS=Caenorhabditis elegans GN=ssl-1 PE=2 SV=4 1534 1701 3.0E-42
sp|P22082|SNF2_YEAST Transcription regulatory protein SNF2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF2 PE=1 SV=1 1543 1695 1.0E-41
sp|Q3B7N1|CHD1L_BOVIN Chromodomain-helicase-DNA-binding protein 1-like OS=Bos taurus GN=CHD1L PE=2 SV=1 1539 1695 1.0E-41
sp|Q9US25|HRP1_SCHPO Chromodomain helicase hrp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp1 PE=1 SV=1 1535 1697 2.0E-41
sp|P25439|BRM_DROME ATP-dependent helicase brm OS=Drosophila melanogaster GN=brm PE=1 SV=2 1543 1695 3.0E-41
sp|F4IV99|CHR5_ARATH Protein CHROMATIN REMODELING 5 OS=Arabidopsis thaliana GN=CHR5 PE=3 SV=1 1536 1693 3.0E-41
sp|Q86WJ1|CHD1L_HUMAN Chromodomain-helicase-DNA-binding protein 1-like OS=Homo sapiens GN=CHD1L PE=1 SV=2 1543 1695 3.0E-41
sp|O14139|HRP3_SCHPO Chromodomain helicase hrp3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=hrp3 PE=1 SV=1 1536 1697 3.0E-41
sp|F4IHS2|SYD_ARATH Chromatin structure-remodeling complex protein SYD OS=Arabidopsis thaliana GN=SYD PE=1 SV=1 1532 1746 5.0E-41
sp|P32657|CHD1_YEAST Chromo domain-containing protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CHD1 PE=1 SV=1 1536 1697 5.0E-41
sp|Q9CXF7|CHD1L_MOUSE Chromodomain-helicase-DNA-binding protein 1-like OS=Mus musculus GN=Chd1l PE=1 SV=1 1537 1695 5.0E-41
sp|Q6DIC0|SMCA2_MOUSE Probable global transcription activator SNF2L2 OS=Mus musculus GN=Smarca2 PE=1 SV=1 1543 1695 6.0E-41
sp|G5EBZ4|LE418_CAEEL Protein let-418 OS=Caenorhabditis elegans GN=let-418 PE=1 SV=1 1539 1748 8.0E-41
sp|P51531|SMCA2_HUMAN Probable global transcription activator SNF2L2 OS=Homo sapiens GN=SMARCA2 PE=1 SV=2 1543 1695 9.0E-41
sp|D3ZD32|CHD5_RAT Chromodomain-helicase-DNA-binding protein 5 OS=Rattus norvegicus GN=Chd5 PE=1 SV=1 1539 1698 1.0E-40
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 1539 1717 1.0E-40
sp|A2A8L1|CHD5_MOUSE Chromodomain-helicase-DNA-binding protein 5 OS=Mus musculus GN=Chd5 PE=1 SV=1 1539 1698 2.0E-40
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5 OS=Homo sapiens GN=CHD5 PE=1 SV=1 1539 1698 2.0E-40
sp|Q7ZU90|CHD1L_DANRE Chromodomain-helicase-DNA-binding protein 1-like OS=Danio rerio GN=chd1l PE=2 SV=1 1537 1699 2.0E-40
sp|Q9XFH4|DDM1_ARATH ATP-dependent DNA helicase DDM1 OS=Arabidopsis thaliana GN=DDM1 PE=1 SV=1 1532 1725 3.0E-40
sp|Q7G8Y3|ISW2_ORYSJ Probable chromatin-remodeling complex ATPase chain OS=Oryza sativa subsp. japonica GN=Os01g0367900 PE=2 SV=2 1539 1695 4.0E-40
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 955 1265 7.0E-40
sp|Q8RWY3|ISW2_ARATH ISWI chromatin-remodeling complex ATPase CHR11 OS=Arabidopsis thaliana GN=CHR11 PE=1 SV=4 1539 1695 1.0E-39
sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana GN=PKL PE=1 SV=1 1535 1692 1.0E-39
sp|F4JY24|CHR17_ARATH ISWI chromatin-remodeling complex ATPase CHR17 OS=Arabidopsis thaliana GN=CHR17 PE=1 SV=1 1539 1695 2.0E-39
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3 OS=Homo sapiens GN=CHD3 PE=1 SV=3 1539 1698 2.0E-39
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 959 1275 2.0E-39
sp|O14646|CHD1_HUMAN Chromodomain-helicase-DNA-binding protein 1 OS=Homo sapiens GN=CHD1 PE=1 SV=2 1535 1693 3.0E-39
sp|P40201|CHD1_MOUSE Chromodomain-helicase-DNA-binding protein 1 OS=Mus musculus GN=Chd1 PE=1 SV=3 1535 1693 3.0E-39
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 956 1265 3.0E-39
sp|B6ZLK2|CHD1_CHICK Chromodomain-helicase-DNA-binding protein 1 OS=Gallus gallus GN=CHD1 PE=1 SV=1 1535 1693 4.0E-39
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 935 1265 3.0E-38
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 956 1267 6.0E-38
sp|P43610|IRC5_YEAST Uncharacterized ATP-dependent helicase IRC5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC5 PE=1 SV=2 1535 1695 1.0E-37
sp|A9X4T1|CHD1_BOMMO Chromodomain-helicase-DNA-binding protein 1 OS=Bombyx mori GN=CHD1 PE=1 SV=1 1501 1693 3.0E-37
sp|O74842|FFT2_SCHPO ATP-dependent helicase fft2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft2 PE=1 SV=1 1534 1681 3.0E-37
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3 OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3 1536 1698 3.0E-37
sp|Q9JIX5|CHD8_RAT Chromodomain-helicase-DNA-binding protein 8 OS=Rattus norvegicus GN=Chd8 PE=1 SV=2 1482 1735 5.0E-37
sp|Q09XV5|CHD8_MOUSE Chromodomain-helicase-DNA-binding protein 8 OS=Mus musculus GN=Chd8 PE=1 SV=1 1482 1735 5.0E-37
sp|Q06A37|CHD7_CHICK Chromodomain-helicase-DNA-binding protein 7 OS=Gallus gallus GN=CHD7 PE=2 SV=1 1536 1693 8.0E-37
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 950 1262 8.0E-37
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 1543 1695 9.0E-37
sp|A2AJK6|CHD7_MOUSE Chromodomain-helicase-DNA-binding protein 7 OS=Mus musculus GN=Chd7 PE=1 SV=1 1482 1693 1.0E-36
sp|Q9P2D1|CHD7_HUMAN Chromodomain-helicase-DNA-binding protein 7 OS=Homo sapiens GN=CHD7 PE=1 SV=3 1482 1693 1.0E-36
sp|B0R0I6|CHD8_DANRE Chromodomain-helicase-DNA-binding protein 8 OS=Danio rerio GN=chd8 PE=3 SV=2 1523 1693 1.0E-36
sp|B5DE69|CHD8_XENTR Chromodomain-helicase-DNA-binding protein 8 OS=Xenopus tropicalis GN=chd8 PE=2 SV=2 1523 1693 2.0E-36
sp|Q9HCK8|CHD8_HUMAN Chromodomain-helicase-DNA-binding protein 8 OS=Homo sapiens GN=CHD8 PE=1 SV=5 1482 1735 2.0E-36
sp|G5EDG2|SMRCD_CAEEL SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 homolog OS=Caenorhabditis elegans GN=M03C11.8 PE=3 SV=1 1537 1700 2.0E-36
sp|F4JTF6|CHR7_ARATH CHD3-type chromatin-remodeling factor CHR7 OS=Arabidopsis thaliana GN=CHR7 PE=2 SV=1 1521 1692 2.0E-36
sp|Q8BYH8|CHD9_MOUSE Chromodomain-helicase-DNA-binding protein 9 OS=Mus musculus GN=Chd9 PE=1 SV=2 1528 1693 3.0E-36
sp|Q5FWR0|SMRCD_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Xenopus tropicalis GN=smarcad1 PE=2 SV=1 1537 1684 5.0E-36
sp|F4KBP5|CHR4_ARATH Protein CHROMATIN REMODELING 4 OS=Arabidopsis thaliana GN=CHR4 PE=2 SV=1 1540 1769 6.0E-36
sp|D3Z9Z9|SMRCD_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Rattus norvegicus GN=Smarcad1 PE=1 SV=1 1539 1700 8.0E-36
sp|Q3L8U1|CHD9_HUMAN Chromodomain-helicase-DNA-binding protein 9 OS=Homo sapiens GN=CHD9 PE=1 SV=2 1536 1693 9.0E-36
sp|Q04692|SMRCD_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Mus musculus GN=Smarcad1 PE=1 SV=2 1539 1700 1.0E-35
sp|Q8TD26|CHD6_HUMAN Chromodomain-helicase-DNA-binding protein 6 OS=Homo sapiens GN=CHD6 PE=1 SV=4 1536 1725 1.0E-35
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 880 1267 1.0E-35
sp|Q9H4L7|SMRCD_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Homo sapiens GN=SMARCAD1 PE=1 SV=2 1539 1700 2.0E-35
sp|F4IV45|CHR10_ARATH Probable helicase CHR10 OS=Arabidopsis thaliana GN=CHR10 PE=3 SV=1 1537 1692 2.0E-35
sp|Q03468|ERCC6_HUMAN DNA excision repair protein ERCC-6 OS=Homo sapiens GN=ERCC6 PE=1 SV=1 1543 1693 2.0E-35
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 1543 1684 2.0E-35
sp|D3ZA12|CHD6_RAT Chromodomain-helicase-DNA-binding protein 6 OS=Rattus norvegicus GN=Chd6 PE=1 SV=2 1536 1693 3.0E-35
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4 OS=Mus musculus GN=Chd4 PE=1 SV=1 1560 1698 4.0E-35
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4 OS=Homo sapiens GN=CHD4 PE=1 SV=2 1560 1698 4.0E-35
sp|A3KFM7|CHD6_MOUSE Chromodomain-helicase-DNA-binding protein 6 OS=Mus musculus GN=Chd6 PE=1 SV=1 1536 1693 4.0E-35
sp|E1B7X9|SMRCD_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1 OS=Bos taurus GN=SMARCAD1 PE=3 SV=2 1539 1700 5.0E-35
sp|E7F1C4|SMRDB_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1B OS=Danio rerio GN=smarcad1b PE=3 SV=1 1539 1686 1.0E-34
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 1543 1693 2.0E-34
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 1539 1689 2.0E-34
sp|Q9ZUL5|CHR19_ARATH Protein CHROMATIN REMODELING 19 OS=Arabidopsis thaliana GN=ETL1 PE=1 SV=1 1540 1696 3.0E-34
sp|B0R061|SMRDA_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A containing DEAD/H box 1A OS=Danio rerio GN=smarcad1a PE=3 SV=1 1539 1675 1.0E-33
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 963 1259 9.0E-33
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 1540 1746 9.0E-33
sp|Q9ZV43|CHR8_ARATH Protein CHROMATIN REMODELING 8 OS=Arabidopsis thaliana GN=CHR8 PE=2 SV=1 956 1267 3.0E-32
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 1539 1689 4.0E-32
sp|O43065|MOT1_SCHPO Probable helicase mot1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mot1 PE=1 SV=4 1561 1771 5.0E-32
sp|A6QQR4|ERC6L_BOVIN DNA excision repair protein ERCC-6-like OS=Bos taurus GN=ERCC6L PE=2 SV=1 959 1199 5.0E-32
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 1539 1689 5.0E-32
sp|A2BGR3|ERC6L_DANRE DNA excision repair protein ERCC-6-like OS=Danio rerio GN=ercc6l PE=1 SV=1 962 1199 1.0E-31
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 1539 1689 2.0E-31
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 897 1265 2.0E-31
sp|Q6EVK6|BRM_ARATH ATP-dependent helicase BRM OS=Arabidopsis thaliana GN=BRM PE=1 SV=1 1539 1667 3.0E-31
sp|Q2NKX8|ERC6L_HUMAN DNA excision repair protein ERCC-6-like OS=Homo sapiens GN=ERCC6L PE=1 SV=1 959 1280 4.0E-31
sp|Q8BHK9|ERC6L_MOUSE DNA excision repair protein ERCC-6-like OS=Mus musculus GN=Ercc6l PE=1 SV=1 962 1361 5.0E-31
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 963 1271 6.0E-31
sp|O42861|FFT3_SCHPO ATP-dependent helicase fft3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft3 PE=1 SV=1 1542 1700 7.0E-31
sp|P32333|MOT1_YEAST TATA-binding protein-associated factor MOT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MOT1 PE=1 SV=1 1561 1700 1.0E-30
sp|P87114|FFT1_SCHPO ATP-dependent helicase fft1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=fft1 PE=3 SV=1 1542 1681 2.0E-30
sp|Q8W103|CHR24_ARATH Protein CHROMATIN REMODELING 24 OS=Arabidopsis thaliana GN=CHR24 PE=2 SV=1 1543 1684 2.0E-30
sp|Q9UR24|RHP26_SCHPO DNA repair protein rhp26 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp26 PE=3 SV=1 956 1267 2.0E-30
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 956 1271 2.0E-30
sp|Q9P793|MIT1_SCHPO Chromatin remodeling factor mit1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mit1 PE=1 SV=1 1543 1694 5.0E-30
sp|Q9JIM3|ER6L2_MOUSE DNA excision repair protein ERCC-6-like 2 OS=Mus musculus GN=Ercc6l2 PE=1 SV=3 1543 1692 6.0E-30
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 1488 1692 6.0E-30
sp|O14981|BTAF1_HUMAN TATA-binding protein-associated factor 172 OS=Homo sapiens GN=BTAF1 PE=1 SV=2 1561 1703 7.0E-30
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 944 1268 8.0E-30
sp|F4I2H2|CHR9_ARATH Switch 2 OS=Arabidopsis thaliana GN=SWI2 PE=3 SV=1 864 1236 9.0E-30
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 1543 1692 1.0E-29
sp|B5BT18|BTAF1_ARATH TATA-binding protein-associated factor BTAF1 OS=Arabidopsis thaliana GN=BTAF1 PE=1 SV=1 1561 1694 2.0E-29
sp|A3KMX0|ER6L2_BOVIN DNA excision repair protein ERCC-6-like 2 OS=Bos taurus GN=ERCC6L2 PE=2 SV=3 956 1221 2.0E-29
sp|P40352|RAD26_YEAST DNA repair and recombination protein RAD26 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD26 PE=1 SV=1 1543 1685 3.0E-29
sp|Q5T890|ER6L2_HUMAN DNA excision repair protein ERCC-6-like 2 OS=Homo sapiens GN=ERCC6L2 PE=1 SV=2 956 1221 3.0E-29
sp|Q8CHI8|EP400_MOUSE E1A-binding protein p400 OS=Mus musculus GN=Ep400 PE=1 SV=3 1534 1705 8.0E-29
sp|Q96L91|EP400_HUMAN E1A-binding protein p400 OS=Homo sapiens GN=EP400 PE=1 SV=4 1534 1705 3.0E-28
sp|Q9DG67|RA54B_CHICK DNA repair and recombination protein RAD54B OS=Gallus gallus GN=RAD54B PE=2 SV=1 1542 1702 6.0E-28
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 1542 1689 9.0E-28
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 1542 1689 1.0E-27
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 1542 1689 1.0E-27
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 1542 1689 1.0E-27
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 1542 1689 1.0E-27
sp|P31380|FUN30_YEAST ATP-dependent helicase FUN30 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FUN30 PE=1 SV=1 1543 1684 4.0E-27
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 956 1269 1.0E-26
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 1539 1693 2.0E-26
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 950 1265 3.0E-26
sp|P41410|RAD54_SCHPO DNA repair protein rhp54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp54 PE=1 SV=2 1543 1692 9.0E-26
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 959 1262 9.0E-26
sp|Q9Y620|RA54B_HUMAN DNA repair and recombination protein RAD54B OS=Homo sapiens GN=RAD54B PE=1 SV=1 1542 1702 1.0E-25
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 1516 1708 1.0E-25
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 943 1265 1.0E-25
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 1543 1692 2.0E-25
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 1543 1759 2.0E-25
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 963 1278 4.0E-25
sp|Q0PCS3|CHR25_ARATH Protein CHROMATIN REMODELING 25 OS=Arabidopsis thaliana GN=CHR25 PE=1 SV=1 1539 1691 5.0E-25
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 1543 1698 6.0E-25
sp|A4PBL4|RAD54_ORYSJ DNA repair and recombination protein RAD54 OS=Oryza sativa subsp. japonica GN=RAD54 PE=1 SV=1 953 1265 1.0E-24
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 1543 1698 2.0E-24
sp|O12944|RAD54_CHICK DNA repair and recombination protein RAD54-like (Fragment) OS=Gallus gallus GN=RAD54L PE=2 SV=1 963 1301 3.0E-24
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 1543 1692 4.0E-24
sp|B3MMA5|RAD54_DROAN DNA repair and recombination protein RAD54-like OS=Drosophila ananassae GN=okr PE=3 SV=1 958 1267 5.0E-24
sp|Q61687|ATRX_MOUSE Transcriptional regulator ATRX OS=Mus musculus GN=Atrx PE=1 SV=3 1519 1693 5.0E-24
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 1543 1692 5.0E-24
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 1543 1692 5.0E-24
sp|Q6PFE3|RA54B_MOUSE DNA repair and recombination protein RAD54B OS=Mus musculus GN=Rad54b PE=2 SV=1 1542 1692 6.0E-24
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 1543 1692 6.0E-24
sp|Q92698|RAD54_HUMAN DNA repair and recombination protein RAD54-like OS=Homo sapiens GN=RAD54L PE=1 SV=2 958 1301 7.0E-24
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 958 1265 7.0E-24
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 1543 1692 7.0E-24
sp|O76460|RAD54_DROME DNA repair and recombination protein RAD54-like OS=Drosophila melanogaster GN=okr PE=1 SV=1 958 1265 8.0E-24
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 1543 1692 8.0E-24
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 1552 1709 9.0E-24
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 1543 1692 1.0E-23
sp|P46100|ATRX_HUMAN Transcriptional regulator ATRX OS=Homo sapiens GN=ATRX PE=1 SV=5 1539 1693 1.0E-23
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 1543 1692 1.0E-23
sp|Q7YQM4|ATRX_PANTR Transcriptional regulator ATRX OS=Pan troglodytes GN=ATRX PE=2 SV=1 1528 1693 1.0E-23
sp|Q7YQM3|ATRX_PONPY Transcriptional regulator ATRX OS=Pongo pygmaeus GN=ATRX PE=2 SV=1 1528 1693 1.0E-23
sp|B4NXB8|RAD54_DROYA DNA repair and recombination protein RAD54-like OS=Drosophila yakuba GN=okr PE=3 SV=2 1543 1692 2.0E-23
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 1543 1692 2.0E-23
sp|P32863|RAD54_YEAST DNA repair and recombination protein RAD54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD54 PE=1 SV=1 985 1265 3.0E-23
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 1509 1688 3.0E-23
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 1562 1687 3.0E-23
sp|B3NAN8|RAD54_DROER DNA repair and recombination protein RAD54-like OS=Drosophila erecta GN=okr PE=3 SV=1 951 1265 4.0E-23
sp|B4M9A8|RAD54_DROVI DNA repair and recombination protein RAD54-like OS=Drosophila virilis GN=okr PE=3 SV=1 944 1265 1.0E-22
sp|B4KHL5|RAD54_DROMO DNA repair and recombination protein RAD54-like OS=Drosophila mojavensis GN=okr PE=3 SV=1 958 1265 2.0E-22
sp|B4JCS7|RAD54_DROGR DNA repair and recombination protein RAD54-like OS=Drosophila grimshawi GN=okr PE=3 SV=1 951 1265 2.0E-22
sp|P70270|RAD54_MOUSE DNA repair and recombination protein RAD54-like OS=Mus musculus GN=Rad54l PE=1 SV=2 958 1265 2.0E-22
sp|Q29KH2|RAD54_DROPS DNA repair and recombination protein RAD54-like OS=Drosophila pseudoobscura pseudoobscura GN=okr PE=3 SV=2 951 1265 3.0E-22
sp|B4GS98|RAD54_DROPE DNA repair and recombination protein RAD54-like OS=Drosophila persimilis GN=okr PE=3 SV=1 951 1265 4.0E-22
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 952 1264 4.0E-22
sp|B4MX21|RAD54_DROWI DNA repair and recombination protein RAD54-like OS=Drosophila willistoni GN=okr PE=3 SV=1 951 1265 7.0E-22
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 1562 1690 9.0E-22
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 1562 1692 1.0E-21
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 1552 1709 2.0E-21
sp|P0CQ66|RAD5_CRYNJ DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RAD5 PE=3 SV=1 1562 1677 3.0E-21
sp|P0CQ67|RAD5_CRYNB DNA repair protein RAD5 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RAD5 PE=3 SV=1 1562 1677 3.0E-21
sp|P47264|Y018_MYCGE Uncharacterized ATP-dependent helicase MG018 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG018 PE=3 SV=3 1562 1689 4.0E-21
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 1552 1709 4.0E-21
sp|Q09772|RDH54_SCHPO Meiotic recombination protein rdh54 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rdh54 PE=1 SV=3 1537 1697 7.0E-21
sp|C7GQI8|RDH54_YEAS2 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain JAY291) GN=RDH54 PE=3 SV=1 985 1264 1.0E-20
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 1560 1692 1.0E-20
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 1564 1677 1.0E-20
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 1524 1685 1.0E-20
sp|P94593|YWQA_BACSU Uncharacterized ATP-dependent helicase YwqA OS=Bacillus subtilis (strain 168) GN=ywqA PE=3 SV=2 1543 1693 2.0E-20
sp|A6ZL17|RDH54_YEAS7 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain YJM789) GN=RDH54 PE=3 SV=1 985 1264 2.0E-20
sp|P38086|RDH54_YEAST DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RDH54 PE=1 SV=4 985 1264 2.0E-20
sp|B5VE38|RDH54_YEAS6 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain AWRI1631) GN=RDH54 PE=3 SV=1 985 1264 2.0E-20
sp|B3LN76|RDH54_YEAS1 DNA repair and recombination protein RDH54 OS=Saccharomyces cerevisiae (strain RM11-1a) GN=RDH54 PE=3 SV=1 985 1264 2.0E-20
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 1547 1677 3.0E-20
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 1562 1687 6.0E-20
sp|P75093|Y020_MYCPN Uncharacterized ATP-dependent helicase MPN_020 OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_020 PE=3 SV=1 1562 1693 7.0E-20
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 1535 1677 7.0E-20
sp|Q9FIY7|SM3L3_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 3 OS=Arabidopsis thaliana GN=At5g43530 PE=3 SV=1 900 1265 8.0E-20
sp|F4HW51|CHR20_ARATH Protein CHROMATIN REMODELING 20 OS=Arabidopsis thaliana GN=ATRX PE=2 SV=2 948 1221 9.0E-20
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 1542 1694 2.0E-19
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 1556 1698 3.0E-19
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 1564 1699 4.0E-19
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 1518 1705 5.0E-19
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 1557 1677 6.0E-19
sp|O60177|YG42_SCHPO Uncharacterized ATP-dependent helicase C23E6.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.02 PE=3 SV=1 963 1194 8.0E-19
sp|Q08562|ULS1_YEAST ATP-dependent helicase ULS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ULS1 PE=1 SV=1 941 1269 1.0E-18
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 925 1264 1.0E-18
sp|Q9FNI6|SM3L2_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2 OS=Arabidopsis thaliana GN=At5g22750 PE=2 SV=1 941 1264 2.0E-18
sp|A4IHD2|ARIP4_XENTR Helicase ARIP4 OS=Xenopus tropicalis GN=rad54l2 PE=2 SV=1 778 1268 2.0E-18
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 1535 1677 2.0E-18
sp|P34739|TTF2_DROME Transcription termination factor 2 OS=Drosophila melanogaster GN=lds PE=1 SV=2 950 1266 4.0E-18
sp|Q10332|YBMA_SCHPO Uncharacterized ATP-dependent helicase C582.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC582.10c PE=1 SV=1 1562 1709 5.0E-18
sp|Q0P4U8|SMAL1_XENTR SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus tropicalis GN=smarcal1 PE=2 SV=1 1541 1702 1.0E-17
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 1016 1268 1.0E-17
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 1541 1677 2.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1016 1265 2.0E-17
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 1541 1677 2.0E-17
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 1543 1686 4.0E-17
sp|Q498E7|SMAL1_XENLA SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Xenopus laevis GN=smarcal1 PE=2 SV=1 1541 1702 4.0E-17
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 985 1205 5.0E-17
sp|P79051|RHP16_SCHPO ATP-dependent helicase rhp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp16 PE=3 SV=2 1543 1690 6.0E-17
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 1016 1265 6.0E-17
sp|P31244|RAD16_YEAST DNA repair protein RAD16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD16 PE=1 SV=1 954 1264 6.0E-17
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1543 1677 7.0E-17
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 1556 1687 9.0E-17
sp|O13762|YF2C_SCHPO Uncharacterized ATP-dependent helicase C17A2.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC17A2.12 PE=3 SV=1 963 1274 1.0E-16
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 985 1205 2.0E-16
sp|Q9NZC9|SMAL1_HUMAN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Homo sapiens GN=SMARCAL1 PE=1 SV=1 1522 1702 3.0E-16
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 1541 1702 3.0E-16
sp|Q9GQN5|ATRX_DROME Transcriptional regulator ATRX homolog OS=Drosophila melanogaster GN=XNP PE=1 SV=2 926 1222 4.0E-16
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 1543 1692 5.0E-16
sp|Q7S1P9|RAD5_NEUCR DNA repair protein rad5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-41 PE=3 SV=3 979 1328 6.0E-16
sp|Q6FY76|RAD5_CANGA DNA repair protein RAD5 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RAD5 PE=3 SV=1 1547 1677 6.0E-16
sp|Q5NC05|TTF2_MOUSE Transcription termination factor 2 OS=Mus musculus GN=Ttf2 PE=1 SV=2 954 1197 1.0E-15
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 1466 1694 1.0E-15
sp|Q8BJL0|SMAL1_MOUSE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Mus musculus GN=Smarcal1 PE=1 SV=1 1541 1702 1.0E-15
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 979 1264 2.0E-15
sp|P32849|RAD5_YEAST DNA repair protein RAD5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD5 PE=1 SV=1 1547 1705 2.0E-15
sp|Q9UNY4|TTF2_HUMAN Transcription termination factor 2 OS=Homo sapiens GN=TTF2 PE=1 SV=2 951 1197 3.0E-15
sp|Q6NZP1|ZRAB3_MOUSE DNA annealing helicase and endonuclease ZRANB3 OS=Mus musculus GN=Zranb3 PE=1 SV=1 956 1213 3.0E-15
sp|E1BB03|ZRAB3_BOVIN DNA annealing helicase and endonuclease ZRANB3 OS=Bos taurus GN=ZRANB3 PE=3 SV=3 1550 1694 6.0E-15
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 1536 1691 6.0E-15
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 1541 1702 8.0E-15
sp|P36607|RAD5_SCHPO DNA repair protein rad8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad8 PE=1 SV=1 978 1272 2.0E-14
sp|Q5FWF4|ZRAB3_HUMAN DNA annealing helicase and endonuclease ZRANB3 OS=Homo sapiens GN=ZRANB3 PE=1 SV=2 1504 1694 2.0E-14
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 979 1264 2.0E-14
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 1553 1691 3.0E-14
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 1539 1669 4.0E-14
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 1539 1669 4.0E-14
sp|Q5BHD6|RAD5_EMENI DNA repair protein rad5 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=rad5 PE=3 SV=1 1547 1677 5.0E-14
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 1562 1677 5.0E-14
sp|Q4WVM1|RAD5_ASPFU DNA repair protein rad5 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=rad5 PE=3 SV=2 1564 1677 6.0E-14
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 1536 1669 6.0E-14
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 1539 1669 6.0E-14
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 1562 1677 2.0E-13
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 984 1273 4.0E-13
sp|Q9U7E0|ATRX_CAEEL Transcriptional regulator ATRX homolog OS=Caenorhabditis elegans GN=xnp-1 PE=1 SV=1 963 1262 5.0E-13
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 939 1264 5.0E-13
sp|Q4IJ84|RAD5_GIBZE DNA repair protein RAD5 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=RAD5 PE=3 SV=1 979 1272 1.0E-12
sp|O10302|GTA_NPVOP Probable global transactivator OS=Orgyia pseudotsugata multicapsid polyhedrosis virus GN=GTA PE=3 SV=1 1562 1680 1.0E-12
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 1539 1710 1.0E-12
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 1541 1677 2.0E-12
sp|Q6C2R8|RAD5_YARLI DNA repair protein RAD5 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RAD5 PE=3 SV=1 1540 1694 4.0E-12
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 1560 1677 4.0E-12
sp|Q8MNV7|SMAL1_CAEEL Putative SMARCAL1-like protein OS=Caenorhabditis elegans GN=C16A3.1 PE=3 SV=1 1562 1687 5.0E-12
sp|F4I8S3|CLSY3_ARATH SNF2 domain-containing protein CLASSY 3 OS=Arabidopsis thaliana GN=CLSY3 PE=1 SV=1 1562 1692 1.0E-11
sp|Q9Y4B4|ARIP4_HUMAN Helicase ARIP4 OS=Homo sapiens GN=RAD54L2 PE=1 SV=4 1095 1268 2.0E-11
sp|Q99NG0|ARIP4_MOUSE Helicase ARIP4 OS=Mus musculus GN=Rad54l2 PE=1 SV=1 1095 1268 2.0E-11
sp|Q57X81|JBP2_TRYB2 Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) GN=JBP2 PE=1 SV=1 956 1194 2.0E-11
sp|P41447|GTA_NPVAC Probable global transactivator OS=Autographa californica nuclear polyhedrosis virus GN=GTA PE=3 SV=1 1556 1684 3.0E-11
sp|Q7TPQ3|SHPRH_MOUSE E3 ubiquitin-protein ligase SHPRH OS=Mus musculus GN=Shprh PE=1 SV=1 1554 1679 1.0E-10
sp|Q149N8|SHPRH_HUMAN E3 ubiquitin-protein ligase SHPRH OS=Homo sapiens GN=SHPRH PE=1 SV=2 1554 1679 1.0E-10
sp|Q94BR5|CHR28_ARATH Helicase-like transcription factor CHR28 OS=Arabidopsis thaliana GN=CHR28 PE=1 SV=1 1083 1267 2.0E-10
sp|Q6CJM4|RAD5_KLULA DNA repair protein RAD5 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAD5 PE=3 SV=1 984 1268 2.0E-10
sp|O55764|172L_IIV6 Putative helicase 172L OS=Invertebrate iridescent virus 6 GN=IIV6-172L PE=3 SV=1 1562 1694 2.0E-10
sp|Q9M297|CLSY1_ARATH SNF2 domain-containing protein CLASSY 1 OS=Arabidopsis thaliana GN=CLSY1 PE=1 SV=1 1590 1692 3.0E-10
sp|Q9FF61|SM3L1_ARATH Putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 1 OS=Arabidopsis thaliana GN=At5g05130 PE=2 SV=1 1016 1264 4.0E-10
sp|F4K493|CLSY2_ARATH SNF2 domain-containing protein CLASSY 2 OS=Arabidopsis thaliana GN=CLSY2 PE=1 SV=1 1614 1692 5.0E-10
sp|Q4PGG5|RAD5_USTMA DNA repair protein RAD5 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=RAD5 PE=3 SV=1 1016 1268 6.0E-10
sp|Q9VMX6|SMAL1_DROME SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Drosophila melanogaster GN=Marcal1 PE=1 SV=2 955 1204 6.0E-10
sp|Q5ACX1|RAD5_CANAL DNA repair protein RAD5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RAD5 PE=3 SV=1 984 1265 6.0E-10
sp|Q9TTA5|SMAL1_BOVIN SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Bos taurus GN=SMARCAL1 PE=2 SV=2 957 1155 7.0E-10
sp|Q9SIW2|CHR35_ARATH Protein CHROMATIN REMODELING 35 OS=Arabidopsis thaliana GN=DRD1 PE=1 SV=1 1549 1690 8.0E-10
sp|Q9LK10|CLSY4_ARATH SNF2 domain-containing protein CLASSY 4 OS=Arabidopsis thaliana GN=CLSY4 PE=1 SV=1 1562 1692 2.0E-09
sp|Q753V5|RAD5_ASHGO DNA repair protein RAD5 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RAD5 PE=3 SV=2 984 1265 3.0E-09
sp|B2ZFP3|SMAL1_DANRE SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Danio rerio GN=smarcal1 PE=2 SV=1 956 1155 3.0E-09
sp|Q6BIP2|RAD5_DEBHA DNA repair protein RAD5 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RAD5 PE=3 SV=2 984 1264 1.0E-08
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 1616 1677 1.0E-08
sp|Q9M1I1|FB304_ARATH F-box protein At3g54460 OS=Arabidopsis thaliana GN=At3g54460 PE=2 SV=1 1562 1694 2.0E-08
sp|B4F769|SMAL1_RAT SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A-like protein 1 OS=Rattus norvegicus GN=Smarcal1 PE=2 SV=1 985 1155 3.0E-08
sp|Q4QFY1|JBP2_LEIMA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania major GN=JBP2 PE=3 SV=2 956 1144 3.0E-08
sp|Q9LHE4|CHR27_ARATH Helicase-like transcription factor CHR27 OS=Arabidopsis thaliana GN=CHR27 PE=1 SV=1 1083 1267 4.0E-08
sp|P54509|YQHH_BACSU Uncharacterized ATP-dependent helicase YqhH OS=Bacillus subtilis (strain 168) GN=yqhH PE=3 SV=1 982 1179 1.0E-07
sp|Q9M658|MOM1_ARATH Helicase protein MOM1 OS=Arabidopsis thaliana GN=MOM1 PE=1 SV=1 1543 1691 1.0E-07
sp|A4HVU6|JBP2_LEIIN Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania infantum GN=JBP2 PE=3 SV=2 956 1144 2.0E-07
sp|A4H7G5|JBP2_LEIBR Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania braziliensis GN=JBP2 PE=3 SV=1 956 1144 2.0E-07
sp|Q06554|IRC20_YEAST Uncharacterized ATP-dependent helicase IRC20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IRC20 PE=1 SV=1 1562 1677 2.0E-07
sp|B6EU02|JBP2_LEITA Bifunctional helicase and thymine dioxygenase JBP2 OS=Leishmania tarentolae GN=JBP2 PE=1 SV=1 956 1144 4.0E-07
sp|Q4DCH3|JBP2_TRYCC Bifunctional helicase and thymine dioxygenase JBP2 OS=Trypanosoma cruzi (strain CL Brener) GN=JBP2 PE=3 SV=1 953 1144 5.0E-07
sp|Q9UTL9|YIV5_SCHPO Uncharacterized ATP-dependent helicase C144.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.05 PE=3 SV=1 1552 1686 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0005524 ATP binding Yes
GO:0140658 ATP-dependent chromatin remodeler activity Yes
GO:0003677 DNA binding Yes
GO:0017076 purine nucleotide binding No
GO:0140097 catalytic activity, acting on DNA No
GO:0005488 binding No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0043168 anion binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0140657 ATP-dependent activity No
GO:0003676 nucleic acid binding No
GO:0008094 ATP-dependent activity, acting on DNA No
GO:0030554 adenyl nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2970
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4496
Ophiocordyceps australis map64 (Brazil) OphauB2|970 (this protein)
Ophiocordyceps camponoti-floridani Ophcf2|03405
Ophiocordyceps camponoti-rufipedis Ophun1|1271
Ophiocordyceps kimflemingae Ophio5|3876
Ophiocordyceps subramaniannii Hirsu2|505

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|970
MESNFRSTVLQRPHGDDDDGLGRHAQARDANTSPSGLHGDFHHHQSPHHAASHPHHFSPSTLDSSRIGHGSALLQ
SPTRQHPPPLHRHQNHGHTSPFMASSSARGTAAESSLPPPSGMASSASSNHNTTPSHRQQPPLSPRHAHGFYDYP
RREKSASGSFYDPTTDTTKVSDSWRNNSTAPQASTPKHHPRDPYSSYPPSAADKHQPYYNGSYSPPRVSSYASRP
RSPLSHSHPVLPADSLSPPARRPRMPSPTPRPGANASNGSAAIKSESLGPPSSSNLPPPSTSTSRAADPMSFSNI
LSCSEPGPEPTEKASLSNLVEPKLEPEAELEPDTEVDRDNETETEPTPGTKKSEIIVKKKGARKSAKGRASDIRD
AEAPKTKRKSSSSLKKESPAPRTSTKRMANGQPKPKTLSTDTERRIHNFEMQIDHEASKLDPSEFDQDEYEARAQ
KRLRTMADLENERNYIRRQDYAEHAGKKLNNHSELGKRRYDDVFYDEALHEVREQELFAEKERKKDMQRKRRREK
SMAITIEAKEAALARALAAADDEERQKHLRDAERANKKAEQTKLILQKGIKGPARNIELIPDGGTMSSLLTSDAD
TPKHPKARGKHNRPKKSKEQKQAEKESAEAAQALLDAGYELPPREESKVRIKIKGRSKDKDKSHNVDADEADKGR
EKDKSKSKDKGESHKSKKDKDLEQEVKDEAAELEKRFSSKGYNQIYEQIWRDMARKDVSKTFKLAVDSYATKGSN
LKKTAILASKEAKRWQLRTNKGTKDLQARAKRVMRDMMGFWKRNEREERDLRKAAEKQELENARREEADREAARQ
KRKLNFLISQTELYSHFVGKKIKTEEVERSTDNLDAAPDSARKNAKHEDKIDVDEVSEPMTNKVTNFANLDFDNE
DESSLRAAAMANAQNAIAEAQKKARDFNNQGLDMDEEGEMNFQNPTGLGDVEIEQPKLINTQLKEYQLKGLNWLV
NLYEQGINGILADEMGLGKTVQSISVMAYLAEKHDIWGPFLVVAPASTLHNWQQEIAKFVPEFKILPYWGSAGDR
KVLRKFWDRKHSTYRKEAAFHVCVTSYQLVVSDVAYFQKMRWQYMILDEAQAIKSSSSSRWKSLLGFHCRNRLLL
TGTPIQNNMQELWALLHFIMPSLFDSHDEFSEWFSKDIESHAQSNTKLNEDQLKRLHMILKPFMLRRVKKHVQKE
LGDKIEFDVFCDLTYRQRAYYGNLRNQINIMDLVEKATMGDDQDSGTLMNLVMQFRKVCNHPDLFERAEVTSPFS
CGYFAETASFVREGNNIAVGYSTRSLIDFDLPSLIWTRGGRLDLAGSDNDGAGWRNKALGHMMNVWSPENICQSL
DGSKAFSWLRFADVSPGDVYKAAHSSLFWRAAAEMNKSNRLGCISVAYEEPEDGNFVPAHALLQMHTWQKREQRA
QVTHQGALSRLMNVARQDYGDSGLCRLEMAARPRASAPPVQVSCRSISSVAERNNVLFNTSMRKALYRLNSYEEK
ALIEAKVPLEQWPAVGLLPKPDSEKKRFTDIIVPSMQRFVTDSGKLAKLDELLFKLKNEGHRVLLYFQMTRMIDM
MEEYLTYRNFKYCRLDGSTKLEDRRDTVHDFQTRPEIFIFLLSTRAGGLGINLTSADTVIFYDSDWNPTIDSQAM
DRAHRLGQKKQVTVYRLITRGTIEERIRARALQKEEVQRVVIQGGATSVDFSGRRAPENRNRDIAMWLADDEQAE
LIERREKELLESGELEKQKKKGGKRKKAEAAASLDDMYHEGEGNFDDGSKGNASGTATPAESDVKGKKGRSKGAK
RAKTTKQRLAIADGMVDF*
Coding >OphauB2|970
ATGGAAAGCAATTTTCGCTCCACGGTGCTGCAGCGGCCGCACGGCGACGATGACGATGGCCTGGGCCGGCACGCA
CAGGCGCGCGATGCAAACACATCGCCGTCGGGGCTGCACGGCGACTTCCATCATCATCAGTCGCCTCACCACGCC
GCCTCGCACCCGCACCATTTCTCGCCCTCGACGCTCGACAGCAGCCGTATTGGGCATGGCAGCGCGCTGCTCCAG
TCGCCGACGCGCCAGCACCCGCCGCCGCTGCATCGCCACCAGAACCACGGCCACACTAGCCCCTTCATGGCCTCC
TCGTCTGCTCGCGGCACCGCAGCTGAGAGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAAT
CACAACACCACGCCCAGCCATCGACAGCAGCCGCCACTATCGCCGCGTCACGCACATGGCTTTTACGATTACCCT
AGACGAGAAAAATCAGCGTCGGGCAGCTTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGC
AACAACAGCACCGCGCCCCAGGCCTCCACGCCAAAGCATCACCCACGCGACCCCTACTCCTCCTACCCCCCGTCG
GCTGCCGACAAGCACCAGCCATACTACAACGGCTCCTATTCTCCCCCCAGGGTCTCTTCCTACGCCAGCCGCCCA
CGCAGCCCTCTCTCGCATTCTCATCCCGTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCCCGCCGCCCTCGCATG
CCTTCGCCAACCCCCAGGCCTGGCGCCAACGCGTCCAACGGCTCCGCGGCTATCAAGTCGGAGTCGTTGGGCCCA
CCATCATCATCCAATCTGCCTCCTCCATCAACCTCCACCAGTCGTGCTGCCGACCCCATGTCTTTTTCCAATATT
CTCTCTTGCTCCGAGCCCGGGCCCGAGCCCACGGAAAAAGCTTCCCTCTCCAATCTTGTAGAGCCCAAGCTGGAA
CCCGAAGCGGAGCTCGAGCCTGATACCGAAGTCGACAGAGACAACGAGACTGAGACTGAGCCAACCCCCGGCACC
AAGAAGAGCGAGATTATCGTCAAGAAGAAGGGAGCACGCAAGTCAGCCAAGGGTAGGGCTTCGGACATCAGGGAT
GCCGAAGCCCCCAAGACCAAGCGCAAGTCGTCGTCCTCTCTTAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACC
AAGCGCATGGCCAATGGCCAACCAAAGCCCAAGACCTTGTCCACAGATACTGAGCGGAGAATCCACAACTTTGAG
ATGCAGATTGACCACGAGGCTTCAAAATTAGATCCATCCGAGTTTGACCAAGATGAGTACGAGGCTCGAGCACAA
AAGCGGCTTCGCACCATGGCCGACCTGGAGAATGAGCGCAACTACATTCGTCGTCAGGACTATGCCGAACATGCT
GGCAAAAAGCTAAACAATCACTCGGAGCTTGGGAAGCGGCGATATGACGATGTTTTTTACGACGAAGCTCTTCAT
GAAGTTCGGGAGCAAGAACTATTTGCCGAAAAAGAGCGCAAAAAGGACATGCAGCGCAAACGTCGGCGTGAAAAG
TCAATGGCGATTACTATTGAAGCAAAAGAAGCTGCTCTCGCGCGTGCACTAGCCGCTGCTGACGATGAAGAGCGC
CAGAAGCATTTGCGTGATGCTGAGCGTGCAAACAAAAAGGCCGAGCAGACCAAGCTCATACTCCAAAAAGGCATC
AAGGGCCCAGCTCGCAATATCGAGCTCATTCCAGACGGCGGCACCATGTCCAGTCTTTTGACATCTGATGCCGAC
ACGCCCAAACATCCCAAGGCTAGAGGCAAGCACAACCGCCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAG
GAGTCTGCCGAAGCCGCCCAGGCCCTTCTTGACGCTGGCTACGAGTTGCCACCGCGAGAGGAGAGCAAGGTGCGA
ATCAAGATCAAGGGGCGTTCCAAGGACAAGGACAAGAGCCACAATGTGGATGCAGACGAGGCAGACAAGGGCAGA
GAAAAGGACAAGTCCAAGTCCAAGGACAAGGGCGAGTCTCATAAATCCAAGAAGGATAAGGATTTGGAGCAGGAA
GTCAAGGATGAGGCCGCGGAACTTGAAAAGAGGTTTTCTTCAAAAGGCTACAACCAAATCTATGAGCAAATTTGG
CGCGACATGGCTCGCAAAGACGTTAGCAAGACGTTCAAACTCGCTGTTGATTCTTATGCCACAAAGGGCTCAAAT
CTTAAAAAGACGGCCATTTTGGCCTCCAAGGAAGCAAAGAGGTGGCAGCTTCGAACCAACAAGGGCACCAAGGAC
CTTCAAGCGAGAGCCAAGCGTGTGATGCGCGACATGATGGGCTTTTGGAAGCGCAACGAACGGGAGGAGCGTGAT
TTACGCAAGGCGGCGGAAAAGCAGGAGCTAGAAAATGCCCGTCGAGAAGAGGCGGACCGTGAAGCGGCCCGTCAA
AAGAGGAAGCTCAATTTTCTCATTTCTCAGACAGAACTCTACTCGCACTTTGTCGGCAAGAAAATCAAGACGGAA
GAGGTGGAGCGGAGCACCGACAACCTTGACGCGGCTCCAGACTCTGCCCGCAAGAACGCCAAGCATGAGGACAAG
ATTGATGTTGATGAAGTGTCGGAGCCCATGACCAACAAGGTGACCAACTTTGCCAACCTTGATTTTGACAATGAG
GACGAGAGCAGTTTGCGAGCAGCGGCCATGGCGAATGCGCAAAATGCCATTGCAGAGGCGCAAAAGAAGGCGCGA
GACTTCAACAATCAAGGGCTGGACATGGACGAGGAGGGCGAGATGAACTTTCAGAACCCAACCGGGCTGGGCGAC
GTGGAGATTGAACAGCCAAAGCTCATCAATACGCAGCTCAAGGAGTACCAGCTCAAGGGCCTCAACTGGCTCGTC
AACTTGTACGAGCAAGGCATCAATGGTATTTTGGCCGACGAGATGGGCTTGGGCAAGACTGTGCAGTCCATCTCC
GTCATGGCCTACTTGGCAGAGAAGCACGACATTTGGGGCCCCTTTTTGGTGGTGGCACCGGCATCGACACTGCAC
AATTGGCAGCAGGAAATCGCCAAGTTTGTGCCCGAGTTCAAGATTCTTCCCTACTGGGGCAGCGCTGGAGACCGC
AAGGTGCTGCGCAAGTTTTGGGACCGCAAGCACTCGACGTACCGCAAAGAGGCAGCCTTTCACGTGTGCGTCACG
TCGTACCAGCTCGTCGTGTCGGATGTGGCCTACTTTCAGAAGATGCGGTGGCAATACATGATTCTCGACGAGGCA
CAAGCCATCAAGAGCTCATCGAGTTCGCGCTGGAAGTCGCTGCTAGGCTTCCACTGTCGTAATCGGCTGTTGCTC
ACGGGCACGCCCATTCAAAACAACATGCAAGAGCTGTGGGCGCTGCTACACTTCATCATGCCATCGCTCTTTGAC
TCGCATGACGAGTTTAGCGAGTGGTTTTCCAAGGACATTGAGTCTCACGCCCAGAGCAACACAAAGCTCAACGAG
GATCAGCTCAAGCGCCTGCACATGATTCTTAAGCCCTTTATGCTTCGCCGCGTCAAGAAGCACGTTCAAAAGGAG
CTTGGCGACAAGATTGAGTTTGACGTCTTTTGCGATCTCACGTACCGCCAAAGAGCCTACTATGGAAATCTCCGC
AACCAAATCAACATTATGGATCTGGTGGAAAAGGCCACCATGGGCGATGACCAGGACTCGGGCACTCTGATGAAT
CTGGTGATGCAATTCCGCAAGGTGTGCAACCATCCCGACTTGTTTGAGCGCGCCGAGGTGACATCGCCCTTTTCC
TGCGGTTATTTTGCCGAGACTGCATCCTTTGTGCGTGAAGGCAACAACATTGCGGTTGGCTACTCGACGCGCAGT
CTAATCGACTTTGACCTGCCGTCGCTCATTTGGACTCGTGGGGGTCGTTTGGATCTGGCGGGCAGCGACAATGAC
GGAGCGGGATGGAGAAACAAGGCACTGGGCCACATGATGAATGTTTGGAGCCCTGAAAATATTTGCCAGAGCCTG
GACGGGTCCAAGGCCTTTTCATGGCTGCGATTTGCCGACGTCTCTCCCGGAGATGTGTACAAGGCGGCTCACAGC
AGTCTCTTTTGGCGAGCGGCGGCCGAGATGAACAAGAGCAATCGCCTAGGCTGCATTAGCGTTGCCTATGAAGAG
CCAGAGGACGGCAACTTTGTGCCTGCGCATGCACTGCTGCAGATGCACACCTGGCAGAAGCGCGAGCAGCGGGCA
CAAGTGACGCACCAAGGCGCTCTGTCGAGACTGATGAACGTTGCCAGGCAAGACTATGGCGATAGTGGCCTTTGC
CGGCTGGAGATGGCGGCGCGGCCTCGGGCGTCGGCTCCTCCAGTGCAAGTGTCGTGCAGAAGCATCAGCAGCGTG
GCAGAGCGCAATAATGTTCTCTTCAACACGAGCATGCGCAAAGCGCTCTATAGGCTCAACAGCTATGAAGAAAAG
GCGCTGATTGAGGCCAAGGTGCCGCTGGAGCAGTGGCCGGCGGTTGGCTTGCTGCCCAAGCCAGACAGCGAGAAG
AAGCGCTTCACCGACATTATCGTGCCGTCAATGCAGCGCTTCGTGACGGACAGCGGCAAGCTGGCCAAGCTGGAC
GAGCTGCTCTTCAAGCTCAAGAATGAGGGCCACCGCGTGCTGCTCTACTTCCAAATGACGCGCATGATTGACATG
ATGGAGGAATACCTGACGTATCGCAACTTCAAGTACTGCCGCCTAGACGGCTCGACCAAGCTCGAGGACAGGCGT
GACACGGTGCACGATTTCCAGACGCGGCCAGAAATCTTCATCTTCCTCTTGTCTACGCGCGCTGGCGGCCTGGGC
ATCAACCTCACCTCGGCCGACACTGTCATATTCTACGACTCGGACTGGAACCCGACAATTGACTCGCAGGCCATG
GACCGAGCACACAGGCTGGGCCAGAAGAAGCAGGTGACGGTGTACCGGCTCATCACGCGCGGGACGATTGAAGAG
CGCATTCGCGCCAGAGCTCTGCAAAAGGAAGAGGTGCAGCGCGTCGTGATTCAAGGCGGCGCTACAAGCGTCGAC
TTTTCGGGACGCCGTGCGCCAGAGAATCGCAACCGCGACATTGCCATGTGGCTGGCCGACGACGAGCAGGCTGAG
CTGATTGAGCGCCGCGAGAAGGAGCTGCTCGAGTCTGGAGAGCTGGAGAAGCAAAAGAAGAAGGGTGGCAAGCGC
AAAAAGGCTGAAGCTGCTGCCAGCCTCGATGACATGTACCACGAGGGCGAGGGCAACTTTGACGACGGCAGCAAA
GGCAATGCTTCTGGCACGGCAACGCCTGCCGAGAGCGACGTCAAGGGGAAAAAGGGTCGAAGCAAAGGAGCCAAG
AGAGCCAAAACGACCAAGCAGCGCCTCGCCATTGCCGATGGCATGGTTGATTTCTGA
Transcript >OphauB2|970
ATGGAAAGCAATTTTCGCTCCACGGTGCTGCAGCGGCCGCACGGCGACGATGACGATGGCCTGGGCCGGCACGCA
CAGGCGCGCGATGCAAACACATCGCCGTCGGGGCTGCACGGCGACTTCCATCATCATCAGTCGCCTCACCACGCC
GCCTCGCACCCGCACCATTTCTCGCCCTCGACGCTCGACAGCAGCCGTATTGGGCATGGCAGCGCGCTGCTCCAG
TCGCCGACGCGCCAGCACCCGCCGCCGCTGCATCGCCACCAGAACCACGGCCACACTAGCCCCTTCATGGCCTCC
TCGTCTGCTCGCGGCACCGCAGCTGAGAGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAAT
CACAACACCACGCCCAGCCATCGACAGCAGCCGCCACTATCGCCGCGTCACGCACATGGCTTTTACGATTACCCT
AGACGAGAAAAATCAGCGTCGGGCAGCTTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGC
AACAACAGCACCGCGCCCCAGGCCTCCACGCCAAAGCATCACCCACGCGACCCCTACTCCTCCTACCCCCCGTCG
GCTGCCGACAAGCACCAGCCATACTACAACGGCTCCTATTCTCCCCCCAGGGTCTCTTCCTACGCCAGCCGCCCA
CGCAGCCCTCTCTCGCATTCTCATCCCGTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCCCGCCGCCCTCGCATG
CCTTCGCCAACCCCCAGGCCTGGCGCCAACGCGTCCAACGGCTCCGCGGCTATCAAGTCGGAGTCGTTGGGCCCA
CCATCATCATCCAATCTGCCTCCTCCATCAACCTCCACCAGTCGTGCTGCCGACCCCATGTCTTTTTCCAATATT
CTCTCTTGCTCCGAGCCCGGGCCCGAGCCCACGGAAAAAGCTTCCCTCTCCAATCTTGTAGAGCCCAAGCTGGAA
CCCGAAGCGGAGCTCGAGCCTGATACCGAAGTCGACAGAGACAACGAGACTGAGACTGAGCCAACCCCCGGCACC
AAGAAGAGCGAGATTATCGTCAAGAAGAAGGGAGCACGCAAGTCAGCCAAGGGTAGGGCTTCGGACATCAGGGAT
GCCGAAGCCCCCAAGACCAAGCGCAAGTCGTCGTCCTCTCTTAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACC
AAGCGCATGGCCAATGGCCAACCAAAGCCCAAGACCTTGTCCACAGATACTGAGCGGAGAATCCACAACTTTGAG
ATGCAGATTGACCACGAGGCTTCAAAATTAGATCCATCCGAGTTTGACCAAGATGAGTACGAGGCTCGAGCACAA
AAGCGGCTTCGCACCATGGCCGACCTGGAGAATGAGCGCAACTACATTCGTCGTCAGGACTATGCCGAACATGCT
GGCAAAAAGCTAAACAATCACTCGGAGCTTGGGAAGCGGCGATATGACGATGTTTTTTACGACGAAGCTCTTCAT
GAAGTTCGGGAGCAAGAACTATTTGCCGAAAAAGAGCGCAAAAAGGACATGCAGCGCAAACGTCGGCGTGAAAAG
TCAATGGCGATTACTATTGAAGCAAAAGAAGCTGCTCTCGCGCGTGCACTAGCCGCTGCTGACGATGAAGAGCGC
CAGAAGCATTTGCGTGATGCTGAGCGTGCAAACAAAAAGGCCGAGCAGACCAAGCTCATACTCCAAAAAGGCATC
AAGGGCCCAGCTCGCAATATCGAGCTCATTCCAGACGGCGGCACCATGTCCAGTCTTTTGACATCTGATGCCGAC
ACGCCCAAACATCCCAAGGCTAGAGGCAAGCACAACCGCCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAG
GAGTCTGCCGAAGCCGCCCAGGCCCTTCTTGACGCTGGCTACGAGTTGCCACCGCGAGAGGAGAGCAAGGTGCGA
ATCAAGATCAAGGGGCGTTCCAAGGACAAGGACAAGAGCCACAATGTGGATGCAGACGAGGCAGACAAGGGCAGA
GAAAAGGACAAGTCCAAGTCCAAGGACAAGGGCGAGTCTCATAAATCCAAGAAGGATAAGGATTTGGAGCAGGAA
GTCAAGGATGAGGCCGCGGAACTTGAAAAGAGGTTTTCTTCAAAAGGCTACAACCAAATCTATGAGCAAATTTGG
CGCGACATGGCTCGCAAAGACGTTAGCAAGACGTTCAAACTCGCTGTTGATTCTTATGCCACAAAGGGCTCAAAT
CTTAAAAAGACGGCCATTTTGGCCTCCAAGGAAGCAAAGAGGTGGCAGCTTCGAACCAACAAGGGCACCAAGGAC
CTTCAAGCGAGAGCCAAGCGTGTGATGCGCGACATGATGGGCTTTTGGAAGCGCAACGAACGGGAGGAGCGTGAT
TTACGCAAGGCGGCGGAAAAGCAGGAGCTAGAAAATGCCCGTCGAGAAGAGGCGGACCGTGAAGCGGCCCGTCAA
AAGAGGAAGCTCAATTTTCTCATTTCTCAGACAGAACTCTACTCGCACTTTGTCGGCAAGAAAATCAAGACGGAA
GAGGTGGAGCGGAGCACCGACAACCTTGACGCGGCTCCAGACTCTGCCCGCAAGAACGCCAAGCATGAGGACAAG
ATTGATGTTGATGAAGTGTCGGAGCCCATGACCAACAAGGTGACCAACTTTGCCAACCTTGATTTTGACAATGAG
GACGAGAGCAGTTTGCGAGCAGCGGCCATGGCGAATGCGCAAAATGCCATTGCAGAGGCGCAAAAGAAGGCGCGA
GACTTCAACAATCAAGGGCTGGACATGGACGAGGAGGGCGAGATGAACTTTCAGAACCCAACCGGGCTGGGCGAC
GTGGAGATTGAACAGCCAAAGCTCATCAATACGCAGCTCAAGGAGTACCAGCTCAAGGGCCTCAACTGGCTCGTC
AACTTGTACGAGCAAGGCATCAATGGTATTTTGGCCGACGAGATGGGCTTGGGCAAGACTGTGCAGTCCATCTCC
GTCATGGCCTACTTGGCAGAGAAGCACGACATTTGGGGCCCCTTTTTGGTGGTGGCACCGGCATCGACACTGCAC
AATTGGCAGCAGGAAATCGCCAAGTTTGTGCCCGAGTTCAAGATTCTTCCCTACTGGGGCAGCGCTGGAGACCGC
AAGGTGCTGCGCAAGTTTTGGGACCGCAAGCACTCGACGTACCGCAAAGAGGCAGCCTTTCACGTGTGCGTCACG
TCGTACCAGCTCGTCGTGTCGGATGTGGCCTACTTTCAGAAGATGCGGTGGCAATACATGATTCTCGACGAGGCA
CAAGCCATCAAGAGCTCATCGAGTTCGCGCTGGAAGTCGCTGCTAGGCTTCCACTGTCGTAATCGGCTGTTGCTC
ACGGGCACGCCCATTCAAAACAACATGCAAGAGCTGTGGGCGCTGCTACACTTCATCATGCCATCGCTCTTTGAC
TCGCATGACGAGTTTAGCGAGTGGTTTTCCAAGGACATTGAGTCTCACGCCCAGAGCAACACAAAGCTCAACGAG
GATCAGCTCAAGCGCCTGCACATGATTCTTAAGCCCTTTATGCTTCGCCGCGTCAAGAAGCACGTTCAAAAGGAG
CTTGGCGACAAGATTGAGTTTGACGTCTTTTGCGATCTCACGTACCGCCAAAGAGCCTACTATGGAAATCTCCGC
AACCAAATCAACATTATGGATCTGGTGGAAAAGGCCACCATGGGCGATGACCAGGACTCGGGCACTCTGATGAAT
CTGGTGATGCAATTCCGCAAGGTGTGCAACCATCCCGACTTGTTTGAGCGCGCCGAGGTGACATCGCCCTTTTCC
TGCGGTTATTTTGCCGAGACTGCATCCTTTGTGCGTGAAGGCAACAACATTGCGGTTGGCTACTCGACGCGCAGT
CTAATCGACTTTGACCTGCCGTCGCTCATTTGGACTCGTGGGGGTCGTTTGGATCTGGCGGGCAGCGACAATGAC
GGAGCGGGATGGAGAAACAAGGCACTGGGCCACATGATGAATGTTTGGAGCCCTGAAAATATTTGCCAGAGCCTG
GACGGGTCCAAGGCCTTTTCATGGCTGCGATTTGCCGACGTCTCTCCCGGAGATGTGTACAAGGCGGCTCACAGC
AGTCTCTTTTGGCGAGCGGCGGCCGAGATGAACAAGAGCAATCGCCTAGGCTGCATTAGCGTTGCCTATGAAGAG
CCAGAGGACGGCAACTTTGTGCCTGCGCATGCACTGCTGCAGATGCACACCTGGCAGAAGCGCGAGCAGCGGGCA
CAAGTGACGCACCAAGGCGCTCTGTCGAGACTGATGAACGTTGCCAGGCAAGACTATGGCGATAGTGGCCTTTGC
CGGCTGGAGATGGCGGCGCGGCCTCGGGCGTCGGCTCCTCCAGTGCAAGTGTCGTGCAGAAGCATCAGCAGCGTG
GCAGAGCGCAATAATGTTCTCTTCAACACGAGCATGCGCAAAGCGCTCTATAGGCTCAACAGCTATGAAGAAAAG
GCGCTGATTGAGGCCAAGGTGCCGCTGGAGCAGTGGCCGGCGGTTGGCTTGCTGCCCAAGCCAGACAGCGAGAAG
AAGCGCTTCACCGACATTATCGTGCCGTCAATGCAGCGCTTCGTGACGGACAGCGGCAAGCTGGCCAAGCTGGAC
GAGCTGCTCTTCAAGCTCAAGAATGAGGGCCACCGCGTGCTGCTCTACTTCCAAATGACGCGCATGATTGACATG
ATGGAGGAATACCTGACGTATCGCAACTTCAAGTACTGCCGCCTAGACGGCTCGACCAAGCTCGAGGACAGGCGT
GACACGGTGCACGATTTCCAGACGCGGCCAGAAATCTTCATCTTCCTCTTGTCTACGCGCGCTGGCGGCCTGGGC
ATCAACCTCACCTCGGCCGACACTGTCATATTCTACGACTCGGACTGGAACCCGACAATTGACTCGCAGGCCATG
GACCGAGCACACAGGCTGGGCCAGAAGAAGCAGGTGACGGTGTACCGGCTCATCACGCGCGGGACGATTGAAGAG
CGCATTCGCGCCAGAGCTCTGCAAAAGGAAGAGGTGCAGCGCGTCGTGATTCAAGGCGGCGCTACAAGCGTCGAC
TTTTCGGGACGCCGTGCGCCAGAGAATCGCAACCGCGACATTGCCATGTGGCTGGCCGACGACGAGCAGGCTGAG
CTGATTGAGCGCCGCGAGAAGGAGCTGCTCGAGTCTGGAGAGCTGGAGAAGCAAAAGAAGAAGGGTGGCAAGCGC
AAAAAGGCTGAAGCTGCTGCCAGCCTCGATGACATGTACCACGAGGGCGAGGGCAACTTTGACGACGGCAGCAAA
GGCAATGCTTCTGGCACGGCAACGCCTGCCGAGAGCGACGTCAAGGGGAAAAAGGGTCGAAGCAAAGGAGCCAAG
AGAGCCAAAACGACCAAGCAGCGCCTCGCCATTGCCGATGGCATGGTTGATTTCTGA
Gene >OphauB2|970
ATGGAAAGCAATTTTCGCTCCACGGTGCTGCAGCGGCCGCACGGCGACGATGACGATGGCCTGGGCCGGCACGCA
CAGGCGCGCGATGCAAACACATCGCCGTCGGGGCTGCACGGCGACTTCCATCATCATCAGTCGCCTCACCACGCC
GCCTCGCACCCGCACCATTTCTCGCCCTCGACGCTCGACAGCAGCCGTATTGGGCATGGCAGCGCGCTGCTCCAG
TCGCCGACGCGCCAGCACCCGCCGCCGCTGCATCGCCACCAGAACCACGGCCACACTAGCCCCTTCATGGCCTCC
TCGTCTGCTCGCGGCACCGCAGCTGAGAGTTCGCTGCCGCCGCCTTCCGGAATGGCCTCATCCGCCTCGTCCAAT
CACAACACCACGCCCAGCCATCGACAGCAGCCGCCACTATCGCCGCGTCACGCACATGGCTTTTACGATTACCCT
AGACGAGAAAAATCAGCGTCGGGCAGCTTCTACGACCCCACGACCGACACCACCAAGGTCTCAGACTCATGGCGC
AACAACAGCACCGCGCCCCAGGCCTCCACGCCAAAGGTAAGCCCGCCCCCGTAGTCCACTTCTTTTTTTTAACCA
CTCGCACGCACCAACTTGGCTTTTTCCCACGCCAAAAAATTTACATCTTGCCACAACACTTGCTTGCGGCCATGC
ACCGTGGCCCCCATAATTTATCTCCCGCTTTGCCGGCTTTTGCACCTCATCATGACAGCTTGCAGACTGCAATTC
TAACGCGACTTTTTTCAATTTAGCATCACCCACGCGACCCCTACTCCTCCTACCCCCCGTCGGCTGCCGACAAGC
ACCAGCCATACTACAACGGCTCCTATTCTCCCCCCAGGGTCTCTTCCTACGCCAGCCGCCCACGCAGCCCTCTCT
CGCATTCTCATCCCGTCCTCCCTGCCGACTCCCTTAGCCCGCCCGCCCGCCGCCCTCGCATGCCTTCGCCAACCC
CCAGGCCTGGCGCCAACGCGTCCAACGGCTCCGCGGCTATCAAGTCGGAGTCGTTGGGCCCACCATCATCATCCA
ATCTGCCTCCTCCATCAACCGTAAGCTGCCACCTGTCAGCCCCCCCCTCAAAGCCCTCCAAAGCTGACACCTGCC
AGTCCACCAGTCGTGCTGCCGACCCCATGTCTTTTTCCAATATTCTCTCTTGCTCCGAGCCCGGGCCCGAGCCCA
CGGAAAAAGCTTCCCTCTCCAATCTTGTAGAGCCCAAGCTGGAACCCGAAGCGGAGCTCGAGCCTGATACCGAAG
TCGACAGAGACAACGAGACTGAGACTGAGCCAACCCCCGGCACCAAGAAGAGCGAGATTATCGTCAAGAAGAAGG
GAGCACGCAAGTCAGCCAAGGGTAGGGCTTCGGACATCAGGGATGCCGAAGCCCCCAAGACCAAGCGCAAGTCGT
CGTCCTCTCTTAAGAAGGAGTCTCCTGCGCCTCGCACTTCCACCAAGCGCATGGCCAATGGCCAACCAAAGCCCA
AGACCTTGTCCACAGATACTGAGCGGAGAATCCACAACTTTGAGATGCAGATTGACCACGAGGCTTCAAAATTAG
ATCCATCCGAGTTTGACCAAGATGAGTACGAGGCTCGAGCACAAAAGCGGCTTCGCACCATGGCCGACCTGGAGA
ATGAGCGCAACTACATTCGTCGTCAGGACTATGCCGAACATGCTGGCAAAAAGCTAAACAATCACTCGGAGCTTG
GGAAGCGGCGATATGACGATGTTTTTTACGACGAAGCTCTTCATGAAGTTCGGGAGCAAGAACTATTTGCCGAAA
AAGAGCGCAAAAAGGACATGCAGCGCAAACGTCGGCGTGAAAAGTCAATGGCGATTACTATTGAAGCAAAAGAAG
CTGCTCTCGCGCGTGCACTAGCCGCTGCTGACGATGAAGAGCGCCAGAAGCATTTGCGTGATGCTGAGCGTGCAA
ACAAAAAGGCCGAGCAGACCAAGCTCATACTCCAAAAAGGCATCAAGGGCCCAGCTCGCAATATCGAGCTCATTC
CAGACGGCGGCACCATGTCCAGTCTTTTGACATCTGATGCCGACACGCCCAAACATCCCAAGGCTAGAGGCAAGC
ACAACCGCCCTAAAAAGTCCAAGGAGCAGAAGCAGGCCGAGAAGGAGTCTGCCGAAGCCGCCCAGGCCCTTCTTG
ACGCTGGCTACGAGTTGCCACCGCGAGAGGAGAGCAAGGTGCGAATCAAGATCAAGGGGCGTTCCAAGGACAAGG
ACAAGAGCCACAATGTGGATGCAGACGAGGCAGACAAGGGCAGAGAAAAGGACAAGTCCAAGTCCAAGGACAAGG
GCGAGTCTCATAAATCCAAGAAGGATAAGGATTTGGAGCAGGAAGTCAAGGATGAGGCCGCGGAACTTGAAAAGA
GGTTTTCTTCAAAAGGCTACAACCAAATCTATGAGCAAATTTGGCGCGACATGGCTCGCAAAGACGTTAGCAAGA
CGTTCAAACTCGCTGTTGATTCTTATGCCACAAAGGGCTCAAATCTTAAAAAGACGGCCATTTTGGCCTCCAAGG
AAGCAAAGAGGTGGCAGCTTCGAACCAACAAGGGCACCAAGGACCTTCAAGCGAGAGCCAAGCGTGTGATGCGCG
ACATGATGGGCTTTTGGAAGCGCAACGAACGGGAGGAGCGTGATTTACGCAAGGCGGCGGAAAAGCAGGAGCTAG
AAAATGCCCGTCGAGAAGAGGCGGACCGTGAAGCGGCCCGTCAAAAGAGGAAGCTCAATTTTCTCATTTCTCAGA
CAGAACTCTACTCGCACTTTGTCGGCAAGAAAATCAAGACGGAAGAGGTGGAGCGGAGCACCGACAACCTTGACG
CGGCTCCAGACTCTGCCCGCAAGAACGCCAAGCATGAGGACAAGATTGATGTTGATGAAGTGTCGGAGCCCATGA
CCAACAAGGTGACCAACTTTGCCAACCTTGATTTTGACAATGAGGACGAGAGCAGTTTGCGAGCAGCGGCCATGG
CGAATGCGCAAAATGCCATTGCAGAGGCGCAAAAGAAGGCGCGAGACTTCAACAATCAAGGGCTGGACATGGACG
AGGAGGGCGAGATGAACTTTCAGAACCCAACCGGGCTGGGCGACGTGGAGATTGAACAGCCAAAGCTCATCAATA
CGCAGCTCAAGGAGTACCAGCTCAAGGGCCTCAACTGGCTCGTCAACTTGTACGAGCAAGGCATCAATGGTATTT
TGGCCGACGAGATGGGCTTGGGCAAGACTGTGCAGTCCATCTCCGTCATGGCCTACTTGGCAGAGAAGCACGACA
TTTGGGGCCCCTTTTTGGTGGTGGCACCGGCATCGACACTGCACAATTGGCAGCAGGAAATCGCCAAGTTTGTGC
CCGAGTTCAAGATTCTTCCCTACTGGGGCAGCGCTGGAGACCGCAAGGTGCTGCGCAAGTTTTGGGACCGCAAGC
ACTCGACGTACCGCAAAGAGGCAGCCTTTCACGTGTGCGTCACGTCGTACCAGCTCGTCGTGTCGGATGTGGCCT
ACTTTCAGAAGATGCGGTGGCAATACATGATTCTCGACGAGGCACAAGCCATCAAGAGCTCATCGAGTTCGCGCT
GGAAGTCGCTGCTAGGCTTCCACTGTCGTAATCGGCTGTTGCTCACGGGCACGCCCATTCAAAACAACATGCAAG
AGCTGTGGGCGCTGCTACACTTCATCATGCCATCGCTCTTTGACTCGCATGACGAGTTTAGCGAGTGGTTTTCCA
AGGACATTGAGTCTCACGCCCAGAGCAACACAAAGCTCAACGAGGATCAGCTCAAGCGCCTGCACATGATTCTTA
AGCCCTTTATGCTTCGCCGCGTCAAGAAGCACGTTCAAAAGGAGCTTGGCGACAAGATTGAGTTTGACGTCTTTT
GCGATCTCACGTACCGCCAAAGAGCCTACTATGGAAATCTCCGCAACCAAATCAACATTATGGATCTGGTGGAAA
AGGCCACCATGGGCGATGACCAGGACTCGGGCACTCTGATGAATCTGGTGATGCAATTCCGCAAGGTGTGCAACC
ATCCCGACTTGTTTGAGCGCGCCGAGGTGACATCGCCCTTTTCCTGCGGTTATTTTGCCGAGACTGCATCCTTTG
TGCGTGAAGGCAACAACATTGCGGTTGGCTACTCGACGCGCAGTCTAATCGACTTTGACCTGCCGTCGCTCATTT
GGACTCGTGGGGGTCGTTTGGATCTGGCGGGCAGCGACAATGACGGAGCGGGATGGAGAAACAAGGCACTGGGCC
ACATGATGAATGTTTGGAGCCCTGAAAATATTTGCCAGAGCCTGGACGGGTCCAAGGCCTTTTCATGGCTGCGAT
TTGCCGACGTCTCTCCCGGAGATGTGTACAAGGCGGCTCACAGCAGTCTCTTTTGGCGAGCGGCGGCCGAGATGA
ACAAGAGCAATCGCCTAGGCTGCATTAGCGTTGCCTATGAAGAGCCAGAGGACGGCAACTTTGTGCCTGCGCATG
CACTGCTGCAGATGCACACCTGGCAGAAGCGCGAGCAGCGGGCACAAGTGACGCACCAAGGCGCTCTGTCGAGAC
TGATGAACGTTGCCAGGCAAGACTATGGCGATAGTGGCCTTTGCCGGCTGGAGATGGCGGCGCGGCCTCGGGCGT
CGGCTCCTCCAGTGCAAGTGTCGTGCAGAAGCATCAGCAGCGTGGCAGAGCGCAATAATGTTCTCTTCAACACGA
GCATGCGCAAAGCGCTCTATAGGCTCAACAGCTATGAAGAAAAGGCGCTGATTGAGGCCAAGGTGCCGCTGGAGC
AGTGGCCGGCGGTTGGCTTGCTGCCCAAGCCAGACAGCGAGAAGAAGCGCTTCACCGACATTATCGTGCCGTCAA
TGCAGCGCTTCGTGACGGACAGCGGCAAGCTGGCCAAGCTGGACGAGCTGCTCTTCAAGCTCAAGAATGAGGGCC
ACCGCGTGCTGCTCTACTTCCAAATGACGCGCATGATTGACATGATGGAGGAATACCTGACGTATCGCAACTTCA
AGTACTGCCGCCTAGACGGCTCGACCAAGCTCGAGGACAGGCGTGACACGGTGCACGATTTCCAGACGCGGCCAG
AAATCTTCATCTTCCTCTTGTCTACGCGCGCTGGCGGCCTGGGCATCAACCTCACCTCGGCCGACACTGTCATAT
TCTACGACTCGGACTGGAACCCGACAATTGACTCGCAGGCCATGGACCGAGCACACAGGCTGGGCCAGAAGAAGC
AGGTGACGGTGTACCGGCTCATCACGCGCGGGACGATTGAAGAGCGCATTCGCGCCAGAGCTCTGCAAAAGGAAG
AGGTGCAGCGCGTCGTGATTCAAGGCGGCGCTACAAGCGTCGACTTTTCGGGACGCCGTGCGCCAGAGAATCGCA
ACCGCGACATTGCCATGTGGCTGGCCGACGACGAGCAGGCTGAGCTGATTGAGCGCCGCGAGAAGGAGCTGCTCG
AGTCTGGAGAGCTGGAGAAGCAAAAGAAGAAGGGTGGCAAGCGCAAAAAGGCTGAAGCTGCTGCCAGCCTCGATG
ACATGTACCACGAGGGTAAGTCGTCTGACTCGCGGCGACGCGCAAAAGATGGGCCAAGGCTAACTAGTGGTATTA
GGCGAGGGCAACTTTGACGACGGCAGCAAAGGCAATGCTTCTGGCACGGCAACGCCTGCCGAGAGCGACGTCAAG
GGGAAAAAGGGTCGAAGCAAAGGAGCCAAGAGAGCCAAAACGACCAAGCAGCGCCTCGCCATTGCCGATGGCATG
GTTGATTTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail