Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|97
Gene name
LocationContig_1:241367..242225
Strand-
Gene length (bp)858
Transcript length (bp)858
Coding sequence length (bp)858
Protein length (aa) 286

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09995 MPAB_Lcp_cat ER-bound oxygenase mpaB/B'/Rubber oxygenase, catalytic domain 8.2E-39 36 244

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P64958|Y2261_MYCBO Uncharacterized protein Mb2261 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb2261 PE=4 SV=1 46 271 7.0E-13
sp|P9WLH1|Y2237_MYCTU Uncharacterized protein Rv2237 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv2237 PE=1 SV=1 46 271 7.0E-13
sp|P9WLH0|Y2237_MYCTO Uncharacterized protein MT2296 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=MT2296 PE=4 SV=1 46 271 7.0E-13

GO

GO Term Description Terminal node
GO:0016491 oxidoreductase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 56 0.5

Transmembrane Domains

Domain # Start End Length
1 203 220 17
2 240 262 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|97
MAMSCPVLHAESEGVNEVKAGAISIPVLRHTFGRFIYWSGMPLAALLQLAHPAVARGVCKHSRFRQDPYSRCHRS
IVFLVAVMYGTEGEREAICGVVRRQHGRVKGVGYEANDAELQRWVAATGLVATVKVHETFLGAMEQHEQEALCVE
FGMFGTQLGMPASAWFSSWGEFEHYWTGMVQELKVSDEGRELGRMILYELLPWYLGWVQWVVRIFVAAWLPEKFA
RGFGLERGMVACMSFRVLAGLGWILYLLVPVVVWRMATLVLVHDMQRVAAEVVKSQRWSI*
Coding >OphauB2|97
ATGGCCATGTCTTGCCCAGTGTTGCATGCAGAGTCTGAGGGGGTAAACGAGGTCAAGGCTGGAGCAATATCGATT
CCCGTGCTCCGGCACACCTTTGGCAGGTTTATCTACTGGTCAGGAATGCCGCTGGCGGCTTTGCTGCAGCTAGCA
CATCCCGCAGTGGCACGCGGCGTGTGCAAGCACTCACGATTCAGACAGGATCCCTACTCGCGCTGCCACCGGAGC
ATCGTCTTTCTCGTGGCCGTCATGTACGGCACAGAGGGGGAAAGGGAGGCCATTTGCGGCGTGGTGCGGCGGCAG
CACGGGCGGGTCAAGGGCGTGGGCTACGAGGCAAACGACGCGGAGCTGCAGCGATGGGTAGCTGCAACGGGGCTG
GTGGCAACGGTCAAGGTGCACGAGACGTTTTTGGGCGCCATGGAGCAGCACGAGCAAGAGGCGCTGTGTGTCGAG
TTTGGCATGTTTGGCACCCAGTTGGGCATGCCAGCCTCGGCGTGGTTTTCGTCGTGGGGCGAGTTTGAGCATTAC
TGGACGGGCATGGTGCAAGAGTTGAAGGTGTCGGACGAGGGGCGGGAGCTGGGGAGGATGATTCTCTATGAGCTG
CTGCCGTGGTACTTGGGCTGGGTGCAGTGGGTGGTGAGGATATTTGTGGCGGCGTGGTTGCCGGAAAAGTTTGCC
AGAGGGTTTGGATTGGAGAGGGGCATGGTGGCGTGCATGAGTTTTAGAGTCTTGGCTGGGCTGGGCTGGATCTTG
TATTTGCTGGTGCCCGTGGTGGTGTGGAGGATGGCGACGCTCGTCTTGGTCCATGACATGCAGCGCGTGGCGGCA
GAGGTGGTTAAAAGCCAGCGCTGGAGCATTTGA
Transcript >OphauB2|97
ATGGCCATGTCTTGCCCAGTGTTGCATGCAGAGTCTGAGGGGGTAAACGAGGTCAAGGCTGGAGCAATATCGATT
CCCGTGCTCCGGCACACCTTTGGCAGGTTTATCTACTGGTCAGGAATGCCGCTGGCGGCTTTGCTGCAGCTAGCA
CATCCCGCAGTGGCACGCGGCGTGTGCAAGCACTCACGATTCAGACAGGATCCCTACTCGCGCTGCCACCGGAGC
ATCGTCTTTCTCGTGGCCGTCATGTACGGCACAGAGGGGGAAAGGGAGGCCATTTGCGGCGTGGTGCGGCGGCAG
CACGGGCGGGTCAAGGGCGTGGGCTACGAGGCAAACGACGCGGAGCTGCAGCGATGGGTAGCTGCAACGGGGCTG
GTGGCAACGGTCAAGGTGCACGAGACGTTTTTGGGCGCCATGGAGCAGCACGAGCAAGAGGCGCTGTGTGTCGAG
TTTGGCATGTTTGGCACCCAGTTGGGCATGCCAGCCTCGGCGTGGTTTTCGTCGTGGGGCGAGTTTGAGCATTAC
TGGACGGGCATGGTGCAAGAGTTGAAGGTGTCGGACGAGGGGCGGGAGCTGGGGAGGATGATTCTCTATGAGCTG
CTGCCGTGGTACTTGGGCTGGGTGCAGTGGGTGGTGAGGATATTTGTGGCGGCGTGGTTGCCGGAAAAGTTTGCC
AGAGGGTTTGGATTGGAGAGGGGCATGGTGGCGTGCATGAGTTTTAGAGTCTTGGCTGGGCTGGGCTGGATCTTG
TATTTGCTGGTGCCCGTGGTGGTGTGGAGGATGGCGACGCTCGTCTTGGTCCATGACATGCAGCGCGTGGCGGCA
GAGGTGGTTAAAAGCCAGCGCTGGAGCATTTGA
Gene >OphauB2|97
ATGGCCATGTCTTGCCCAGTGTTGCATGCAGAGTCTGAGGGGGTAAACGAGGTCAAGGCTGGAGCAATATCGATT
CCCGTGCTCCGGCACACCTTTGGCAGGTTTATCTACTGGTCAGGAATGCCGCTGGCGGCTTTGCTGCAGCTAGCA
CATCCCGCAGTGGCACGCGGCGTGTGCAAGCACTCACGATTCAGACAGGATCCCTACTCGCGCTGCCACCGGAGC
ATCGTCTTTCTCGTGGCCGTCATGTACGGCACAGAGGGGGAAAGGGAGGCCATTTGCGGCGTGGTGCGGCGGCAG
CACGGGCGGGTCAAGGGCGTGGGCTACGAGGCAAACGACGCGGAGCTGCAGCGATGGGTAGCTGCAACGGGGCTG
GTGGCAACGGTCAAGGTGCACGAGACGTTTTTGGGCGCCATGGAGCAGCACGAGCAAGAGGCGCTGTGTGTCGAG
TTTGGCATGTTTGGCACCCAGTTGGGCATGCCAGCCTCGGCGTGGTTTTCGTCGTGGGGCGAGTTTGAGCATTAC
TGGACGGGCATGGTGCAAGAGTTGAAGGTGTCGGACGAGGGGCGGGAGCTGGGGAGGATGATTCTCTATGAGCTG
CTGCCGTGGTACTTGGGCTGGGTGCAGTGGGTGGTGAGGATATTTGTGGCGGCGTGGTTGCCGGAAAAGTTTGCC
AGAGGGTTTGGATTGGAGAGGGGCATGGTGGCGTGCATGAGTTTTAGAGTCTTGGCTGGGCTGGGCTGGATCTTG
TATTTGCTGGTGCCCGTGGTGGTGTGGAGGATGGCGACGCTCGTCTTGGTCCATGACATGCAGCGCGTGGCGGCA
GAGGTGGTTAAAAGCCAGCGCTGGAGCATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail