Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|968
Gene name
LocationContig_120:33125..33435
Strand-
Gene length (bp)310
Transcript length (bp)255
Coding sequence length (bp)255
Protein length (aa) 85

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P12685|TRK1_YEAST High-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK1 PE=1 SV=1 1 78 4.0E-11
sp|P28569|TRK1_SACUV High-affinity potassium transport protein OS=Saccharomyces uvarum GN=TRK1 PE=3 SV=1 1 70 5.0E-10
sp|P28584|TRK2_YEAST Low-affinity potassium transport protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRK2 PE=1 SV=1 1 70 3.0E-09
sp|Q10065|TRK2_SCHPO Potassium transport protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk2 PE=2 SV=1 1 70 3.0E-07
sp|P47946|TRK1_SCHPO Potassium transport protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=trk1 PE=3 SV=2 7 68 2.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.5

Transmembrane Domains

Domain # Start End Length
1 38 60 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|968
MYPYGNISAIDAYFMGCSASTESGLATVDLKELALYQQIYLYVTPMLTNMGFVNIVVVLVRLHWFNKRIDKTGKS
VQRWEFLGC*
Coding >OphauB2|968
ATGTACCCGTACGGAAACATTAGTGCTATAGATGCCTACTTTATGGGCTGTAGTGCCTCGACCGAGTCCGGACTG
GCAACGGTCGATCTCAAGGAGCTGGCGCTATATCAGCAGATTTATCTCTACGTCACGCCCATGCTTACAAACATG
GGTTTTGTGAATATAGTCGTGGTGCTTGTTCGGCTGCACTGGTTTAATAAGCGCATCGACAAGACTGGCAAGTCT
GTCCAGAGGTGGGAGTTTCTGGGATGCTAA
Transcript >OphauB2|968
ATGTACCCGTACGGAAACATTAGTGCTATAGATGCCTACTTTATGGGCTGTAGTGCCTCGACCGAGTCCGGACTG
GCAACGGTCGATCTCAAGGAGCTGGCGCTATATCAGCAGATTTATCTCTACGTCACGCCCATGCTTACAAACATG
GGTTTTGTGAATATAGTCGTGGTGCTTGTTCGGCTGCACTGGTTTAATAAGCGCATCGACAAGACTGGCAAGTCT
GTCCAGAGGTGGGAGTTTCTGGGATGCTAA
Gene >OphauB2|968
ATGTACCCGTACGGAAACATTAGTGCTATAGATGCCTACTTTATGGGCTGTAGTGCCTCGACCGAGTCCGGACTG
GCAACGTATATCCCCCGAGTCTTTTAGCCAAGGGCAAGAGAGGCTAACGTGTCGTCACAGGGTCGATCTCAAGGA
GCTGGCGCTATATCAGCAGATTTATCTCTACGTCACGCCCATGCTTACAAACATGGGTTTTGTGAATATAGTCGT
GGTGCTTGTTCGGCTGCACTGGTTTAATAAGCGCATCGACAAGACTGGCAAGTCTGTCCAGAGGTGGGAGTTTCT
GGGATGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail