Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|962
Gene name
LocationContig_120:21072..22693
Strand+
Gene length (bp)1621
Transcript length (bp)1446
Coding sequence length (bp)1446
Protein length (aa) 482

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10355 Ytp1 Protein of unknown function (Ytp1) 6.2E-69 161 404
PF10348 DUF2427 Domain of unknown function (DUF2427) 1.2E-29 36 133

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P53584|YTP1_YEAST Protein YTP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YTP1 PE=1 SV=1 162 453 8.0E-68
sp|O59714|YBH6_SCHPO Uncharacterized membrane protein C3B8.06 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3B8.06 PE=1 SV=1 142 391 3.0E-12
sp|P25639|YCV1_YEAST Uncharacterized membrane protein YCR061W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YCR061W PE=1 SV=2 218 373 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 47 69 22
2 76 98 22
3 108 130 22
4 151 173 22
5 188 210 22
6 281 298 17
7 308 330 22
8 343 365 22
9 380 402 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|962
MTLHLGFGALSLIPFILANTVRGHDHHMGNSKIVAGDTISQDPIDTTLWIHIFIQTLAYGVIFPIGMVFGITKSR
WHVPTQATGSALALVGFFLGHAHGGREFVGGNIHAVFSNLLQLLLICQIVLGLYLKGHWERGVNGRIRKLIRPCH
SILGKAMPVLSWIQMLFGGITALGFCQGDHLGQCLAHFIMGSAFIAYGILLTIILVVGQVWLRRCGRSQEFFDSA
VITAWGCVNTFTEHRWGTEWVRNDWQHTTMGIIWWCAGLAGMWLSSDRDGNPKRNFVPGFVIFLTGWAMSAHPQE
LMVSAETHSMFGKTLMAAGVTRIIEIAFVLRDQQSLSHDGRTWNSFQYVPVFLLYAAGFLFMGATEEQMNLVDQS
SLDHVSYILIIFSLAFLMFSFANMLIYLYDRLANPVENVKSLSNGHMRINGRAVEEGQLRDAEEFELDGLMSDDE
GEEVRQMLRRSVDNLGPESPSTLGKNNETSV*
Coding >OphauB2|962
ATGACTCTCCATTTAGGCTTTGGGGCTTTGTCCCTTATTCCTTTCATCCTCGCAAATACGGTTCGGGGACACGAT
CATCACATGGGCAACAGCAAGATTGTCGCCGGAGATACCATCTCCCAGGATCCCATAGACACGACACTATGGATC
CACATTTTCATTCAGACGCTTGCTTATGGCGTCATCTTTCCCATAGGCATGGTCTTTGGCATCACCAAGTCTCGA
TGGCACGTTCCTACACAAGCCACCGGCTCCGCGCTTGCCCTCGTAGGCTTCTTCCTCGGCCATGCACACGGCGGT
CGCGAGTTTGTTGGGGGCAACATTCATGCCGTCTTTTCAAATCTGCTGCAGCTGCTCCTCATCTGCCAAATCGTC
CTTGGCCTCTATCTCAAAGGCCACTGGGAAAGGGGCGTCAATGGCAGAATTAGAAAACTCATTCGTCCATGCCAC
TCCATCCTCGGCAAAGCAATGCCTGTCCTGTCCTGGATCCAGATGCTCTTCGGTGGCATTACCGCTCTCGGCTTC
TGCCAGGGTGATCATTTGGGCCAGTGCTTGGCGCACTTCATCATGGGCAGCGCCTTTATCGCTTACGGCATCCTC
TTGACCATTATCCTTGTTGTCGGCCAAGTCTGGCTTCGCAGGTGCGGGCGCTCACAGGAATTCTTCGACAGCGCC
GTCATTACCGCTTGGGGCTGTGTCAACACCTTTACTGAGCATCGCTGGGGCACCGAATGGGTCAGAAACGATTGG
CAACATACCACCATGGGAATCATTTGGTGGTGCGCGGGCCTAGCGGGCATGTGGCTCAGCAGTGACCGCGATGGT
AACCCCAAACGCAACTTTGTACCCGGCTTTGTCATCTTCTTGACTGGCTGGGCCATGTCGGCTCACCCTCAGGAA
CTCATGGTCAGCGCAGAAACGCACAGCATGTTTGGCAAGACGCTCATGGCGGCTGGTGTTACACGCATTATTGAA
ATTGCATTTGTGCTTCGGGACCAACAATCTCTTTCGCACGACGGTCGCACTTGGAACAGTTTTCAATACGTTCCT
GTATTTCTCTTGTACGCCGCTGGCTTCCTTTTCATGGGGGCCACCGAGGAACAGATGAATTTGGTCGACCAGTCG
TCACTTGACCACGTCTCATACATTCTCATCATCTTTTCGCTCGCATTCTTGATGTTTTCGTTTGCCAACATGCTC
ATTTACCTGTACGATCGGCTTGCGAACCCAGTGGAAAATGTCAAGAGCCTTTCCAATGGACATATGCGAATCAAT
GGCCGGGCAGTTGAGGAGGGACAGCTTCGTGATGCTGAGGAATTCGAGCTGGACGGCCTCATGAGTGATGATGAG
GGCGAAGAAGTGCGCCAAATGCTGAGACGAAGCGTGGATAACCTCGGCCCAGAATCTCCGAGCACTCTTGGCAAG
AACAATGAGACGTCGGTTTAG
Transcript >OphauB2|962
ATGACTCTCCATTTAGGCTTTGGGGCTTTGTCCCTTATTCCTTTCATCCTCGCAAATACGGTTCGGGGACACGAT
CATCACATGGGCAACAGCAAGATTGTCGCCGGAGATACCATCTCCCAGGATCCCATAGACACGACACTATGGATC
CACATTTTCATTCAGACGCTTGCTTATGGCGTCATCTTTCCCATAGGCATGGTCTTTGGCATCACCAAGTCTCGA
TGGCACGTTCCTACACAAGCCACCGGCTCCGCGCTTGCCCTCGTAGGCTTCTTCCTCGGCCATGCACACGGCGGT
CGCGAGTTTGTTGGGGGCAACATTCATGCCGTCTTTTCAAATCTGCTGCAGCTGCTCCTCATCTGCCAAATCGTC
CTTGGCCTCTATCTCAAAGGCCACTGGGAAAGGGGCGTCAATGGCAGAATTAGAAAACTCATTCGTCCATGCCAC
TCCATCCTCGGCAAAGCAATGCCTGTCCTGTCCTGGATCCAGATGCTCTTCGGTGGCATTACCGCTCTCGGCTTC
TGCCAGGGTGATCATTTGGGCCAGTGCTTGGCGCACTTCATCATGGGCAGCGCCTTTATCGCTTACGGCATCCTC
TTGACCATTATCCTTGTTGTCGGCCAAGTCTGGCTTCGCAGGTGCGGGCGCTCACAGGAATTCTTCGACAGCGCC
GTCATTACCGCTTGGGGCTGTGTCAACACCTTTACTGAGCATCGCTGGGGCACCGAATGGGTCAGAAACGATTGG
CAACATACCACCATGGGAATCATTTGGTGGTGCGCGGGCCTAGCGGGCATGTGGCTCAGCAGTGACCGCGATGGT
AACCCCAAACGCAACTTTGTACCCGGCTTTGTCATCTTCTTGACTGGCTGGGCCATGTCGGCTCACCCTCAGGAA
CTCATGGTCAGCGCAGAAACGCACAGCATGTTTGGCAAGACGCTCATGGCGGCTGGTGTTACACGCATTATTGAA
ATTGCATTTGTGCTTCGGGACCAACAATCTCTTTCGCACGACGGTCGCACTTGGAACAGTTTTCAATACGTTCCT
GTATTTCTCTTGTACGCCGCTGGCTTCCTTTTCATGGGGGCCACCGAGGAACAGATGAATTTGGTCGACCAGTCG
TCACTTGACCACGTCTCATACATTCTCATCATCTTTTCGCTCGCATTCTTGATGTTTTCGTTTGCCAACATGCTC
ATTTACCTGTACGATCGGCTTGCGAACCCAGTGGAAAATGTCAAGAGCCTTTCCAATGGACATATGCGAATCAAT
GGCCGGGCAGTTGAGGAGGGACAGCTTCGTGATGCTGAGGAATTCGAGCTGGACGGCCTCATGAGTGATGATGAG
GGCGAAGAAGTGCGCCAAATGCTGAGACGAAGCGTGGATAACCTCGGCCCAGAATCTCCGAGCACTCTTGGCAAG
AACAATGAGACGTCGGTTTAG
Gene >OphauB2|962
ATGACTCTCCATTTAGGCTTTGGGGCTTTGTCCCTTATTCCTTTCATCCTCGCAAATACGGTTCGGGGACACGAT
CATCACATGGGCAACAGCAAGATTGTCGCCGGAGATACCATCTCCCAGGATCCCATAGTAGGCAAATCGTCATCC
TCTACTCGCCTCTCTCTTGAAACTGACTGCATCTTTGCCAGGACACGACACTATGGATCCACATTTTCATTCAGA
CGCTTGCTTATGGCGTCATCTTTCCCATAGGCATGGTCTTTGGCGTACGACTTGTCTCTCTCGCTTCAACTCTTT
GCAAAACGCTTACTCGCCTGCAATAGATCACCAAGTCTCGATGGCACGTTCCTACACAAGCCACCGGCTCCGCGC
TTGCCCTCGTAGGCTTCTTCCTCGGCCATGCACACGGCGGTCGCGAGTTTGTTGGGGGCAACATTCATGCCGTCT
TTTCAAATCTGCTGCAGCTGCTCCTCATCTGCCAAATCGTCCTTGGCCTCTATCTCAAAGGCCACTGGGAAAGGG
GCGTCAATGGCAGAATTAGAAAACTCATTCGTCCATGCCACTCCATCCTCGGCAAAGCAATGCCTGTCCTGTCCT
GGATCCAGATGCTCTTCGGTGGCATTACCGCTCTCGGCTTCTGCCAGGGTGATCATTTGGGCCAGTGCTTGGCGC
ACTTCATCATGGGCAGCGCCTTTATCGCTTACGGCATCCTCTTGACCATTATCCTTGTTGTCGGCCAAGTCTGGC
TTCGCAGGTGCGGGCGCTCACAGGAATTCTTCGACAGCGCCGTCATTACCGCTTGGGGCTGTGTCAACACCTTTA
CTGAGCATCGCTGGGGCACCGAATGGGTCAGAAACGATTGGCAACATACCACCATGGGAATCATTTGGTGGTGCG
CGGGCCTAGCGGGCATGTGGCTCAGCAGTGACCGCGATGGTAACCCCAAACGCAACTTTGTACCCGGCTTTGTCA
TCTTCTTGACTGGCTGGGCCATGTCGGCTCACCCTCAGGAACTCATGGTCAGCGCAGAAACGCACAGCATGTTTG
GCAAGACGCTCATGGCGGCTGGTGTTACACGCATTATTGAAATTGCATTTGTGCTTCGGGACCAACAATCTCTTT
CGCACGACGGTCGCACTTGGAACAGTTTTCAATACGTTCCTGTATTTGTACGTCTCTTGAGAGCCGACTGCCGAG
TTTGTTTGTTGAAGTGCTGACAAAAAGACAGCTCTTGTACGCCGCTGGCTTCCTTTTCATGGGGGCCACCGAGGA
ACAGATGAATTTGGTCGACCAGTCGTCACTTGACCACGTCTCATACATTCTCATCATCTTTTCGCTCGCATTCTT
GATGTTTTCGTTTGCCAACATGCTCATTTACCTGTACGATCGGCTTGCGAACCCAGTGGAAAATGTCAAGAGCCT
TTCCAATGGACATATGCGAATCAATGGCCGGGCAGTTGAGGAGGGACAGCTTCGTGATGCTGAGGAATTCGAGCT
GGACGGCCTCATGAGTGATGATGAGGGCGAAGAAGTGCGCCAAATGCTGAGACGAAGCGTGGATAACCTCGGCCC
AGAATCTCCGAGCACTCTTGGCAAGAACAATGAGACGTCGGTTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail