Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|956
Gene name
LocationContig_120:9430..10346
Strand-
Gene length (bp)916
Transcript length (bp)849
Coding sequence length (bp)849
Protein length (aa) 283

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01613 Flavin_Reduct Flavin reductase like domain 1.9E-29 114 274

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTQ4|YL3B_SCHPO Uncharacterized protein C1071.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1071.11 PE=4 SV=1 110 178 3.0E-07

GO

GO Term Description Terminal node
GO:0010181 FMN binding Yes
GO:0097367 carbohydrate derivative binding No
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0036094 small molecule binding No
GO:0043168 anion binding No
GO:0032553 ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0097159 organic cyclic compound binding No
GO:0043167 ion binding No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|956
MSYCEAMRNVLLQVQQLAGRHMKAWLRNGNCSRSITSKVTQTSPAQIIALITASKTWRQRRKQVQAGTQPFSRRN
RLIHASSWSRKDFHIEGPSPPTVDSDDGAPLSEQLRSTMRLIAHSVVVCTSSHGPTPRAMTMSSFTSLTLRPTPL
VTFNIAVPSRTFDAIASSGAFNIHVLTGDAAGATVAERFARGNDAGAFERADGVKLGGNNISPVLDGEGVLRVLK
CKVFANGPNGGLVRVRDHVVVLGEVLEMIPVNKAEGFGLTYADRKYRQMGNAIAKRE*
Coding >OphauB2|956
ATGAGCTATTGCGAAGCGATGCGCAATGTATTGCTACAAGTGCAGCAACTCGCAGGGCGGCACATGAAAGCATGG
CTGCGCAACGGGAATTGCTCTCGTAGCATTACATCAAAGGTCACTCAAACTTCACCAGCTCAAATAATAGCTTTG
ATTACTGCTTCAAAGACATGGAGACAACGGCGCAAGCAAGTTCAAGCAGGCACACAGCCTTTTTCCCGTCGAAAC
CGGTTAATACATGCTTCGAGCTGGTCGCGCAAAGACTTTCACATTGAGGGTCCCTCGCCTCCCACCGTTGACTCG
GATGATGGGGCACCGCTGTCAGAACAATTACGGTCGACAATGCGCCTCATTGCACACTCTGTAGTCGTATGCACT
TCTTCTCATGGCCCAACACCTCGTGCAATGACCATGTCGTCGTTTACGTCTCTCACACTGCGTCCCACGCCCCTC
GTCACCTTCAATATCGCAGTTCCAAGCAGGACATTTGATGCTATTGCATCTAGTGGTGCTTTCAACATTCATGTC
TTGACAGGGGATGCGGCAGGTGCGACAGTGGCGGAGCGCTTCGCACGCGGAAATGATGCTGGTGCATTTGAGCGT
GCCGATGGGGTAAAGCTGGGAGGGAACAATATTTCACCAGTGCTGGATGGAGAAGGCGTGCTTCGGGTCCTCAAG
TGCAAAGTCTTTGCAAATGGACCAAATGGAGGGCTGGTGAGAGTGAGGGATCACGTTGTAGTCCTGGGAGAGGTG
CTGGAGATGATACCCGTTAACAAGGCAGAGGGCTTTGGGCTGACATATGCGGACCGCAAATATAGACAGATGGGC
AATGCCATAGCTAAACGAGAATGA
Transcript >OphauB2|956
ATGAGCTATTGCGAAGCGATGCGCAATGTATTGCTACAAGTGCAGCAACTCGCAGGGCGGCACATGAAAGCATGG
CTGCGCAACGGGAATTGCTCTCGTAGCATTACATCAAAGGTCACTCAAACTTCACCAGCTCAAATAATAGCTTTG
ATTACTGCTTCAAAGACATGGAGACAACGGCGCAAGCAAGTTCAAGCAGGCACACAGCCTTTTTCCCGTCGAAAC
CGGTTAATACATGCTTCGAGCTGGTCGCGCAAAGACTTTCACATTGAGGGTCCCTCGCCTCCCACCGTTGACTCG
GATGATGGGGCACCGCTGTCAGAACAATTACGGTCGACAATGCGCCTCATTGCACACTCTGTAGTCGTATGCACT
TCTTCTCATGGCCCAACACCTCGTGCAATGACCATGTCGTCGTTTACGTCTCTCACACTGCGTCCCACGCCCCTC
GTCACCTTCAATATCGCAGTTCCAAGCAGGACATTTGATGCTATTGCATCTAGTGGTGCTTTCAACATTCATGTC
TTGACAGGGGATGCGGCAGGTGCGACAGTGGCGGAGCGCTTCGCACGCGGAAATGATGCTGGTGCATTTGAGCGT
GCCGATGGGGTAAAGCTGGGAGGGAACAATATTTCACCAGTGCTGGATGGAGAAGGCGTGCTTCGGGTCCTCAAG
TGCAAAGTCTTTGCAAATGGACCAAATGGAGGGCTGGTGAGAGTGAGGGATCACGTTGTAGTCCTGGGAGAGGTG
CTGGAGATGATACCCGTTAACAAGGCAGAGGGCTTTGGGCTGACATATGCGGACCGCAAATATAGACAGATGGGC
AATGCCATAGCTAAACGAGAATGA
Gene >OphauB2|956
ATGAGCTATTGCGAAGCGATGCGCAATGTATTGCTACAAGTGCAGCAACTCGCAGGGCGGCACATGAAAGCATGG
CTGCGCAACGGGAATTGCTCTCGTAGCATTACATCAAAGGTCACTCAAACTTCACCAGCTCAAATAATAGCTTTG
ATTACTGCTTCAAAGACATGGAGACAACGGCGCAAGCAAGTTCAAGCAGGCACACAGCCTTTTTGTGAGCATGCA
TGCTCCCATTGGTTACTCTTTTTACCACGAGCCACGACTGACCGGCCAAGTTGCAGCCCGTCGAAACCGGTTAAT
ACATGCTTCGAGCTGGTCGCGCAAAGACTTTCACATTGAGGGTCCCTCGCCTCCCACCGTTGACTCGGATGATGG
GGCACCGCTGTCAGAACAATTACGGTCGACAATGCGCCTCATTGCACACTCTGTAGTCGTATGCACTTCTTCTCA
TGGCCCAACACCTCGTGCAATGACCATGTCGTCGTTTACGTCTCTCACACTGCGTCCCACGCCCCTCGTCACCTT
CAATATCGCAGTTCCAAGCAGGACATTTGATGCTATTGCATCTAGTGGTGCTTTCAACATTCATGTCTTGACAGG
GGATGCGGCAGGTGCGACAGTGGCGGAGCGCTTCGCACGCGGAAATGATGCTGGTGCATTTGAGCGTGCCGATGG
GGTAAAGCTGGGAGGGAACAATATTTCACCAGTGCTGGATGGAGAAGGCGTGCTTCGGGTCCTCAAGTGCAAAGT
CTTTGCAAATGGACCAAATGGAGGGCTGGTGAGAGTGAGGGATCACGTTGTAGTCCTGGGAGAGGTGCTGGAGAT
GATACCCGTTAACAAGGCAGAGGGCTTTGGGCTGACATATGCGGACCGCAAATATAGACAGATGGGCAATGCCAT
AGCTAAACGAGAATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail