Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|955
Gene name
LocationContig_120:6370..8500
Strand-
Gene length (bp)2130
Transcript length (bp)2130
Coding sequence length (bp)2130
Protein length (aa) 710

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00183 HSP90 Hsp90 protein 8.5E-221 182 693
PF02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 2.7E-15 25 179
PF13589 HATPase_c_3 Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase 4.2E-09 24 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43109|HSP90_PODAS Heat shock protein 90 homolog OS=Podospora anserina GN=MOD-E PE=3 SV=1 1 709 0.0E+00
sp|P40292|HSP90_ASPFU Heat shock protein 90 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hsp90 PE=1 SV=3 2 709 0.0E+00
sp|P33125|HSP82_AJECA Heat shock protein 82 OS=Ajellomyces capsulatus GN=HSP82 PE=3 SV=1 2 709 0.0E+00
sp|P46598|HSP90_CANAL Heat shock protein 90 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP90 PE=3 SV=1 2 709 0.0E+00
sp|P15108|HSC82_YEAST ATP-dependent molecular chaperone HSC82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSC82 PE=1 SV=4 2 709 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43109|HSP90_PODAS Heat shock protein 90 homolog OS=Podospora anserina GN=MOD-E PE=3 SV=1 1 709 0.0E+00
sp|P40292|HSP90_ASPFU Heat shock protein 90 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hsp90 PE=1 SV=3 2 709 0.0E+00
sp|P33125|HSP82_AJECA Heat shock protein 82 OS=Ajellomyces capsulatus GN=HSP82 PE=3 SV=1 2 709 0.0E+00
sp|P46598|HSP90_CANAL Heat shock protein 90 homolog OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=HSP90 PE=3 SV=1 2 709 0.0E+00
sp|P15108|HSC82_YEAST ATP-dependent molecular chaperone HSC82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSC82 PE=1 SV=4 2 709 0.0E+00
sp|P02829|HSP82_YEAST ATP-dependent molecular chaperone HSP82 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HSP82 PE=1 SV=1 2 709 0.0E+00
sp|P41887|HSP90_SCHPO Heat shock protein 90 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swo1 PE=1 SV=2 3 709 0.0E+00
sp|Q8J2M3|HSP82_ASHGO Heat shock protein HSP82 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HSP82 PE=3 SV=1 3 709 0.0E+00
sp|P02828|HSP83_DROME Heat shock protein 83 OS=Drosophila melanogaster GN=Hsp83 PE=1 SV=1 2 709 0.0E+00
sp|P30946|HS90A_RABIT Heat shock protein HSP 90-alpha OS=Oryctolagus cuniculus GN=HSP90AA1 PE=1 SV=2 2 709 0.0E+00
sp|Q90474|H90A1_DANRE Heat shock protein HSP 90-alpha 1 OS=Danio rerio GN=hsp90a.1 PE=1 SV=3 2 709 0.0E+00
sp|P04809|HSP83_DROPS Heat shock protein 83 OS=Drosophila pseudoobscura pseudoobscura GN=Hsp83 PE=3 SV=2 2 709 0.0E+00
sp|O02192|HSP83_DROAV Heat shock protein 83 OS=Drosophila auraria GN=Hsp83 PE=3 SV=1 2 709 0.0E+00
sp|P82995|HS90A_RAT Heat shock protein HSP 90-alpha OS=Rattus norvegicus GN=Hsp90aa1 PE=1 SV=3 2 709 0.0E+00
sp|P27323|HS901_ARATH Heat shock protein 90-1 OS=Arabidopsis thaliana GN=HSP90-1 PE=1 SV=3 2 709 0.0E+00
sp|P07901|HS90A_MOUSE Heat shock protein HSP 90-alpha OS=Mus musculus GN=Hsp90aa1 PE=1 SV=4 2 709 0.0E+00
sp|Q04619|HS90B_CHICK Heat shock cognate protein HSP 90-beta OS=Gallus gallus GN=HSP90AB1 PE=2 SV=1 2 709 0.0E+00
sp|O57521|HS90B_DANRE Heat shock protein HSP 90-beta OS=Danio rerio GN=hsp90ab1 PE=1 SV=2 4 709 0.0E+00
sp|P11501|HS90A_CHICK Heat shock protein HSP 90-alpha OS=Gallus gallus GN=HSP90AA1 PE=3 SV=3 2 709 0.0E+00
sp|Q9GKX7|HS90A_HORSE Heat shock protein HSP 90-alpha OS=Equus caballus GN=HSP90AA1 PE=2 SV=2 2 709 0.0E+00
sp|Q76LV2|HS90A_BOVIN Heat shock protein HSP 90-alpha OS=Bos taurus GN=HSP90AA1 PE=1 SV=3 2 709 0.0E+00
sp|P07900|HS90A_HUMAN Heat shock protein HSP 90-alpha OS=Homo sapiens GN=HSP90AA1 PE=1 SV=5 2 709 0.0E+00
sp|Q9BLC5|HSP83_BOMMO Heat shock protein 83 OS=Bombyx mori GN=Hsp83 PE=1 SV=1 2 709 0.0E+00
sp|Q4R4P1|HS90A_MACFA Heat shock protein HSP 90-alpha OS=Macaca fascicularis GN=HSP90AA1 PE=2 SV=3 2 709 0.0E+00
sp|O02705|HS90A_PIG Heat shock protein HSP 90-alpha OS=Sus scrofa GN=HSP90AA1 PE=2 SV=3 2 709 0.0E+00
sp|P46633|HS90A_CRIGR Heat shock protein HSP 90-alpha OS=Cricetulus griseus GN=HSP90AA1 PE=2 SV=2 2 709 0.0E+00
sp|Q08277|HSP82_MAIZE Heat shock protein 82 OS=Zea mays GN=HSP82 PE=3 SV=1 3 709 0.0E+00
sp|A5A6K9|HS90A_PANTR Heat shock protein HSP 90-alpha OS=Pan troglodytes GN=HSP90AA1 PE=2 SV=1 2 709 0.0E+00
sp|P34058|HS90B_RAT Heat shock protein HSP 90-beta OS=Rattus norvegicus GN=Hsp90ab1 PE=1 SV=4 4 709 0.0E+00
sp|P11499|HS90B_MOUSE Heat shock protein HSP 90-beta OS=Mus musculus GN=Hsp90ab1 PE=1 SV=3 4 709 0.0E+00
sp|Q7PT10|HSP83_ANOGA Heat shock protein 83 OS=Anopheles gambiae GN=Hsp83 PE=3 SV=3 2 681 0.0E+00
sp|Q4R4T5|HS90B_MACFA Heat shock protein HSP 90-beta OS=Macaca fascicularis GN=Hsp90ab1 PE=2 SV=1 4 709 0.0E+00
sp|Q9GKX8|HS90B_HORSE Heat shock protein HSP 90-beta OS=Equus caballus GN=HSP90AB1 PE=2 SV=3 4 709 0.0E+00
sp|P51819|HSP83_IPONI Heat shock protein 83 OS=Ipomoea nil GN=HSP83A PE=2 SV=1 2 709 0.0E+00
sp|P08238|HS90B_HUMAN Heat shock protein HSP 90-beta OS=Homo sapiens GN=HSP90AB1 PE=1 SV=4 4 709 0.0E+00
sp|Q76LV1|HS90B_BOVIN Heat shock protein HSP 90-beta OS=Bos taurus GN=HSP90AB1 PE=2 SV=3 4 709 0.0E+00
sp|Q5R710|HS90B_PONAB Heat shock protein HSP 90-beta OS=Pongo abelii GN=HSP90AB1 PE=2 SV=1 4 709 0.0E+00
sp|P24724|HSP90_THEPA Heat shock protein 90 OS=Theileria parva GN=TP02_0244 PE=2 SV=2 3 709 0.0E+00
sp|P06660|HSP85_TRYCR Heat shock-like 85 kDa protein OS=Trypanosoma cruzi PE=3 SV=1 1 709 0.0E+00
sp|Q25293|HSP83_LEIIN Heat shock protein 83-1 OS=Leishmania infantum GN=HSP83-1 PE=3 SV=2 1 709 0.0E+00
sp|P54651|HSC90_DICDI Heat shock cognate 90 kDa protein OS=Dictyostelium discoideum GN=hspD PE=1 SV=2 2 683 0.0E+00
sp|Q4UDU8|HSP90_THEAN Heat shock protein 90 OS=Theileria annulata GN=TA12105 PE=3 SV=1 3 709 0.0E+00
sp|P27741|HSP83_LEIAM Heat shock protein 83 OS=Leishmania amazonensis GN=HSP83 PE=3 SV=1 1 709 0.0E+00
sp|O44001|HSP90_EIMTE Heat shock protein 90 OS=Eimeria tenella GN=HSP90 PE=2 SV=1 3 709 0.0E+00
sp|Q61W58|HSP90_CAEBR Heat shock protein 90 OS=Caenorhabditis briggsae GN=daf-21 PE=3 SV=1 2 709 0.0E+00
sp|O61998|HSP90_BRUPA Heat shock protein 90 OS=Brugia pahangi GN=HSP90 PE=2 SV=2 2 709 0.0E+00
sp|P12861|HSP83_TRYBB Heat shock protein 83 OS=Trypanosoma brucei brucei GN=HSP83 PE=1 SV=1 1 709 0.0E+00
sp|Q18688|HSP90_CAEEL Heat shock protein 90 OS=Caenorhabditis elegans GN=daf-21 PE=1 SV=1 2 709 0.0E+00
sp|Q9STX5|ENPL_ARATH Endoplasmin homolog OS=Arabidopsis thaliana GN=HSP90-7 PE=1 SV=1 2 680 0.0E+00
sp|P36183|ENPL_HORVU Endoplasmin homolog OS=Hordeum vulgare PE=2 SV=1 2 680 0.0E+00
sp|Q66HD0|ENPL_RAT Endoplasmin OS=Rattus norvegicus GN=Hsp90b1 PE=1 SV=2 2 678 0.0E+00
sp|Q95M18|ENPL_BOVIN Endoplasmin OS=Bos taurus GN=HSP90B1 PE=2 SV=1 2 680 0.0E+00
sp|P41148|ENPL_CANLF Endoplasmin OS=Canis lupus familiaris GN=HSP90B1 PE=1 SV=1 2 680 0.0E+00
sp|P08110|ENPL_CHICK Endoplasmin OS=Gallus gallus GN=HSP90B1 PE=1 SV=1 2 680 0.0E+00
sp|P08113|ENPL_MOUSE Endoplasmin OS=Mus musculus GN=Hsp90b1 PE=1 SV=2 2 678 0.0E+00
sp|Q07078|HSP83_ORYSJ Heat shock protein 81-3 OS=Oryza sativa subsp. japonica GN=HSP81-3 PE=1 SV=2 269 709 0.0E+00
sp|Q69QQ6|HSP82_ORYSJ Heat shock protein 81-2 OS=Oryza sativa subsp. japonica GN=HSP81-2 PE=2 SV=1 269 709 0.0E+00
sp|Q22235|ENPL1_CAEEL Endoplasmin homolog OS=Caenorhabditis elegans GN=enpl-1 PE=3 SV=1 2 680 0.0E+00
sp|O03986|HS904_ARATH Heat shock protein 90-4 OS=Arabidopsis thaliana GN=HSP90-4 PE=1 SV=1 269 709 0.0E+00
sp|P36181|HSP80_SOLLC Heat shock cognate protein 80 OS=Solanum lycopersicum GN=HSC80 PE=2 SV=1 269 709 0.0E+00
sp|Q0J4P2|HSP81_ORYSJ Heat shock protein 81-1 OS=Oryza sativa subsp. japonica GN=HSP81-1 PE=3 SV=2 269 709 0.0E+00
sp|A2YWQ1|HSP81_ORYSI Heat shock protein 81-1 OS=Oryza sativa subsp. indica GN=HSP81-1 PE=2 SV=1 269 709 0.0E+00
sp|P55737|HS902_ARATH Heat shock protein 90-2 OS=Arabidopsis thaliana GN=HSP90-2 PE=1 SV=1 269 677 0.0E+00
sp|P51818|HS903_ARATH Heat shock protein 90-3 OS=Arabidopsis thaliana GN=HSP90-3 PE=1 SV=2 269 677 0.0E+00
sp|O18750|ENPL_RABIT Endoplasmin (Fragment) OS=Oryctolagus cuniculus GN=HSP90B1 PE=2 SV=1 9 680 0.0E+00
sp|Q9NKX1|ENPL_DICDI Endoplasmin homolog OS=Dictyostelium discoideum GN=grp94 PE=2 SV=2 2 701 0.0E+00
sp|P36182|HSP82_TOBAC Heat shock protein 82 (Fragment) OS=Nicotiana tabacum GN=HSP82 PE=2 SV=1 198 709 0.0E+00
sp|F4JFN3|HS906_ARATH Heat shock protein 90-6, mitochondrial OS=Arabidopsis thaliana GN=HSP90-6 PE=2 SV=1 2 676 0.0E+00
sp|P27890|HSP83_LEIDO Heat shock protein 83 (Fragment) OS=Leishmania donovani GN=HSP83 PE=2 SV=1 256 709 0.0E+00
sp|Q9SIF2|HS905_ARATH Heat shock protein 90-5, chloroplastic OS=Arabidopsis thaliana GN=HSP90-5 PE=1 SV=1 2 676 0.0E+00
sp|Q1CZI7|HTPG_MYXXD Chaperone protein HtpG OS=Myxococcus xanthus (strain DK 1622) GN=htpG PE=3 SV=1 3 671 1.0E-175
sp|P04810|HSP83_DROSI Heat shock protein 83 (Fragment) OS=Drosophila simulans GN=Hsp83 PE=3 SV=1 2 369 9.0E-175
sp|P04811|HSP83_DROVI Heat shock protein 83 (Fragment) OS=Drosophila virilis GN=Hsp83 PE=3 SV=1 2 369 3.0E-173
sp|A0KL53|HTPG_AERHH Chaperone protein HtpG OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=htpG PE=3 SV=1 2 671 2.0E-164
sp|Q1H2K2|HTPG_METFK Chaperone protein HtpG OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=htpG1 PE=3 SV=1 3 671 2.0E-163
sp|A4SLY0|HTPG_AERS4 Chaperone protein HtpG OS=Aeromonas salmonicida (strain A449) GN=htpG PE=3 SV=1 2 671 1.0E-162
sp|A1WXE4|HTPG_HALHL Chaperone protein HtpG OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=htpG PE=3 SV=1 2 671 3.0E-162
sp|B5EQZ5|HTPG_ACIF5 Chaperone protein HtpG OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=htpG PE=3 SV=1 3 671 6.0E-160
sp|B7JAR2|HTPG_ACIF2 Chaperone protein HtpG OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=htpG PE=3 SV=1 3 671 6.0E-160
sp|Q8SSE8|HSP82_ENCCU Heat shock protein 90 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HSP90 PE=1 SV=1 2 667 1.0E-159
sp|Q3SJW8|HTPG_THIDA Chaperone protein HtpG OS=Thiobacillus denitrificans (strain ATCC 25259) GN=htpG PE=3 SV=1 3 673 3.0E-159
sp|A4XV81|HTPG_PSEMY Chaperone protein HtpG OS=Pseudomonas mendocina (strain ymp) GN=htpG PE=3 SV=1 3 671 4.0E-159
sp|Q9I3C5|HTPG_PSEAE Chaperone protein HtpG OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=htpG PE=3 SV=1 3 671 2.0E-158
sp|Q5P1C5|HTPG_AROAE Chaperone protein HtpG OS=Aromatoleum aromaticum (strain EbN1) GN=htpG PE=3 SV=1 2 671 7.0E-158
sp|Q47GZ8|HTPG_DECAR Chaperone protein HtpG OS=Dechloromonas aromatica (strain RCB) GN=htpG PE=3 SV=1 3 671 2.0E-157
sp|Q4ZUW2|HTPG_PSEU2 Chaperone protein HtpG OS=Pseudomonas syringae pv. syringae (strain B728a) GN=htpG PE=3 SV=2 3 671 3.0E-157
sp|Q883Y9|HTPG_PSESM Chaperone protein HtpG OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=htpG PE=3 SV=1 3 671 3.0E-157
sp|Q7WQ31|HTPG_BORBR Chaperone protein HtpG OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=htpG PE=3 SV=1 2 671 7.0E-157
sp|Q5GZV7|HTPG_XANOR Chaperone protein HtpG OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=htpG PE=3 SV=2 3 671 8.0E-157
sp|Q2P2U8|HTPG_XANOM Chaperone protein HtpG OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=htpG PE=3 SV=1 3 671 8.0E-157
sp|Q48K64|HTPG_PSE14 Chaperone protein HtpG OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=htpG PE=3 SV=1 3 671 8.0E-157
sp|Q3KFT8|HTPG_PSEPF Chaperone protein HtpG OS=Pseudomonas fluorescens (strain Pf0-1) GN=htpG PE=3 SV=1 3 671 3.0E-156
sp|Q3JAF6|HTPG_NITOC Chaperone protein HtpG OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=htpG PE=3 SV=1 3 671 4.0E-156
sp|Q87EN0|HTPG_XYLFT Chaperone protein HtpG OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=htpG PE=3 SV=1 3 671 4.0E-156
sp|Q58FF6|H90B4_HUMAN Putative heat shock protein HSP 90-beta 4 OS=Homo sapiens GN=HSP90AB4P PE=5 SV=1 15 582 4.0E-156
sp|Q7W0M8|HTPG_BORPE Chaperone protein HtpG OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=htpG PE=3 SV=1 2 671 7.0E-156
sp|Q88FB9|HTPG_PSEPK Chaperone protein HtpG OS=Pseudomonas putida (strain KT2440) GN=htpG PE=3 SV=1 3 671 2.0E-155
sp|Q2KYY2|HTPG_BORA1 Chaperone protein HtpG OS=Bordetella avium (strain 197N) GN=htpG PE=3 SV=1 2 671 2.0E-155
sp|Q4KFX8|HTPG_PSEF5 Chaperone protein HtpG OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=htpG PE=3 SV=1 3 671 3.0E-155
sp|Q7WC32|HTPG_BORPA Chaperone protein HtpG OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=htpG PE=3 SV=1 2 671 4.0E-155
sp|A3NSX5|HTPG_BURP0 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 1106a) GN=htpG PE=3 SV=1 3 671 8.0E-155
sp|A3N786|HTPG_BURP6 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 668) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|Q63W07|HTPG_BURPS Chaperone protein HtpG OS=Burkholderia pseudomallei (strain K96243) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|Q3JUM5|HTPG_BURP1 Chaperone protein HtpG OS=Burkholderia pseudomallei (strain 1710b) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|A1V292|HTPG_BURMS Chaperone protein HtpG OS=Burkholderia mallei (strain SAVP1) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|Q62ID1|HTPG_BURMA Chaperone protein HtpG OS=Burkholderia mallei (strain ATCC 23344) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|A2S4I0|HTPG_BURM9 Chaperone protein HtpG OS=Burkholderia mallei (strain NCTC 10229) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|A3MHX8|HTPG_BURM7 Chaperone protein HtpG OS=Burkholderia mallei (strain NCTC 10247) GN=htpG PE=3 SV=1 3 671 1.0E-154
sp|A0K9C0|HTPG_BURCH Chaperone protein HtpG OS=Burkholderia cenocepacia (strain HI2424) GN=htpG PE=3 SV=1 3 671 2.0E-154
sp|Q1BUR7|HTPG_BURCA Chaperone protein HtpG OS=Burkholderia cenocepacia (strain AU 1054) GN=htpG PE=3 SV=1 3 671 2.0E-154
sp|Q46YS9|HTPG_CUPPJ Chaperone protein HtpG OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=htpG PE=3 SV=1 3 671 2.0E-154
sp|Q3IKQ2|HTPG_PSEHT Chaperone protein HtpG OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=htpG PE=3 SV=1 3 671 2.0E-154
sp|Q0BD34|HTPG_BURCM Chaperone protein HtpG OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=htpG PE=3 SV=1 3 671 2.0E-154
sp|A6V7J7|HTPG_PSEA7 Chaperone protein HtpG OS=Pseudomonas aeruginosa (strain PA7) GN=htpG PE=3 SV=1 3 671 3.0E-154
sp|Q4QP81|HTPG_HAEI8 Chaperone protein HtpG OS=Haemophilus influenzae (strain 86-028NP) GN=htpG PE=3 SV=2 3 671 4.0E-154
sp|Q8P855|HTPG_XANCP Chaperone protein HtpG OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=htpG PE=3 SV=1 3 671 5.0E-154
sp|Q2SZZ0|HTPG_BURTA Chaperone protein HtpG OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=htpG PE=3 SV=1 3 671 5.0E-154
sp|Q0AHI5|HTPG_NITEC Chaperone protein HtpG OS=Nitrosomonas eutropha (strain C91) GN=htpG PE=3 SV=1 2 671 6.0E-154
sp|Q9CM20|HTPG_PASMU Chaperone protein HtpG OS=Pasteurella multocida (strain Pm70) GN=htpG PE=3 SV=1 3 671 6.0E-154
sp|A0QEJ0|HTPG_MYCA1 Chaperone protein HtpG OS=Mycobacterium avium (strain 104) GN=htpG PE=3 SV=1 3 665 6.0E-154
sp|Q39E36|HTPG_BURL3 Chaperone protein HtpG OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=htpG PE=3 SV=1 3 671 9.0E-154
sp|Q7NYF6|HTPG_CHRVO Chaperone protein HtpG OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=htpG PE=3 SV=2 3 671 1.0E-153
sp|P61186|HTPG_MYCPA Chaperone protein HtpG OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=htpG PE=3 SV=1 3 665 1.0E-153
sp|Q3BS21|HTPG_XANC5 Chaperone protein HtpG OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=htpG PE=3 SV=1 3 671 2.0E-153
sp|P44516|HTPG_HAEIN Chaperone protein HtpG OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=htpG PE=3 SV=2 3 671 2.0E-153
sp|Q0K8D7|HTPG_CUPNH Chaperone protein HtpG OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=htpG PE=3 SV=1 3 671 2.0E-153
sp|B0TP05|HTPG_SHEHH Chaperone protein HtpG OS=Shewanella halifaxensis (strain HAW-EB4) GN=htpG PE=3 SV=1 3 671 2.0E-153
sp|Q8PJK3|HTPG_XANAC Chaperone protein HtpG OS=Xanthomonas axonopodis pv. citri (strain 306) GN=htpG PE=3 SV=1 3 671 2.0E-153
sp|Q0A738|HTPG_ALKEH Chaperone protein HtpG OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=htpG PE=3 SV=1 3 671 4.0E-153
sp|Q1QUL4|HTPG_CHRSD Chaperone protein HtpG OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=htpG PE=3 SV=1 2 671 7.0E-153
sp|A4TFF4|HTPG_MYCGI Chaperone protein HtpG OS=Mycobacterium gilvum (strain PYR-GCK) GN=htpG PE=3 SV=1 3 671 7.0E-153
sp|Q5X5J7|HTPG_LEGPA Chaperone protein HtpG OS=Legionella pneumophila (strain Paris) GN=htpG PE=3 SV=1 3 671 8.0E-153
sp|Q5QWR2|HTPG_IDILO Chaperone protein HtpG OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=htpG PE=3 SV=1 3 671 9.0E-153
sp|Q9PEQ0|HTPG_XYLFA Chaperone protein HtpG OS=Xylella fastidiosa (strain 9a5c) GN=htpG PE=3 SV=1 3 671 1.0E-152
sp|B8F5X3|HTPG_HAEPS Chaperone protein HtpG OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=htpG PE=3 SV=1 3 671 2.0E-152
sp|A1ANS1|HTPG_PELPD Chaperone protein HtpG OS=Pelobacter propionicus (strain DSM 2379) GN=htpG PE=3 SV=1 4 671 2.0E-152
sp|A5GER7|HTPG_GEOUR Chaperone protein HtpG OS=Geobacter uraniireducens (strain Rf4) GN=htpG PE=3 SV=1 4 671 3.0E-152
sp|Q5ZVS1|HTPG_LEGPH Chaperone protein HtpG OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=htpG PE=3 SV=1 3 671 4.0E-152
sp|A5UB42|HTPG_HAEIE Chaperone protein HtpG OS=Haemophilus influenzae (strain PittEE) GN=htpG PE=3 SV=1 3 671 4.0E-152
sp|Q5WWX9|HTPG_LEGPL Chaperone protein HtpG OS=Legionella pneumophila (strain Lens) GN=htpG PE=3 SV=1 3 671 4.0E-152
sp|P54649|HTPG_AGGAC Chaperone protein HtpG OS=Aggregatibacter actinomycetemcomitans GN=htpG PE=3 SV=1 3 671 5.0E-152
sp|A5IBL1|HTPG_LEGPC Chaperone protein HtpG OS=Legionella pneumophila (strain Corby) GN=htpG PE=3 SV=1 3 671 5.0E-152
sp|A8H2R4|HTPG_SHEPA Chaperone protein HtpG OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=htpG PE=3 SV=1 3 671 8.0E-152
sp|Q82TV8|HTPG_NITEU Chaperone protein HtpG OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=htpG PE=3 SV=1 3 671 8.0E-152
sp|A5UFQ9|HTPG_HAEIG Chaperone protein HtpG OS=Haemophilus influenzae (strain PittGG) GN=htpG PE=3 SV=1 3 671 9.0E-152
sp|Q4UVY7|HTPG_XANC8 Chaperone protein HtpG OS=Xanthomonas campestris pv. campestris (strain 8004) GN=htpG PE=3 SV=1 3 671 1.0E-151
sp|B0USJ0|HTPG_HISS2 Chaperone protein HtpG OS=Histophilus somni (strain 2336) GN=htpG PE=3 SV=1 3 671 1.0E-151
sp|Q0I2A3|HTPG_HAES1 Chaperone protein HtpG OS=Haemophilus somnus (strain 129Pt) GN=htpG PE=3 SV=1 3 671 1.0E-151
sp|A3QF50|HTPG_SHELP Chaperone protein HtpG OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=htpG PE=3 SV=1 3 671 2.0E-151
sp|B0BPS7|HTPG_ACTPJ Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=htpG PE=3 SV=1 3 671 3.0E-151
sp|A3N0Z5|HTPG_ACTP2 Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=htpG PE=3 SV=1 3 671 3.0E-151
sp|C3K6N7|HTPG_PSEFS Chaperone protein HtpG OS=Pseudomonas fluorescens (strain SBW25) GN=htpG PE=3 SV=1 3 671 4.0E-151
sp|Q2YA09|HTPG_NITMU Chaperone protein HtpG OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=htpG PE=3 SV=1 3 670 5.0E-151
sp|Q2SKD0|HTPG_HAHCH Chaperone protein HtpG OS=Hahella chejuensis (strain KCTC 2396) GN=htpG PE=3 SV=1 3 671 6.0E-151
sp|Q0S467|HTPG_RHOJR Chaperone protein HtpG OS=Rhodococcus jostii (strain RHA1) GN=htpG PE=3 SV=1 3 671 8.0E-151
sp|P61188|HTPG_TREDE Chaperone protein HtpG OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=htpG PE=3 SV=1 1 671 1.0E-150
sp|A7MJW4|HTPG_CROS8 Chaperone protein HtpG OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=htpG PE=3 SV=1 3 671 1.0E-150
sp|B3R5J8|HTPG_CUPTR Chaperone protein HtpG OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=htpG PE=3 SV=1 3 671 2.0E-150
sp|B3GXX7|HTPG_ACTP7 Chaperone protein HtpG OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=htpG PE=3 SV=1 3 671 2.0E-150
sp|Q142T5|HTPG_BURXL Chaperone protein HtpG OS=Burkholderia xenovorans (strain LB400) GN=htpG PE=3 SV=1 3 671 2.0E-150
sp|P61185|HTPG_GEOSL Chaperone protein HtpG OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=htpG PE=3 SV=1 7 671 2.0E-150
sp|A8FX83|HTPG_SHESH Chaperone protein HtpG OS=Shewanella sediminis (strain HAW-EB3) GN=htpG PE=3 SV=1 3 671 2.0E-149
sp|Q7N0P4|HTPG_PHOLL Chaperone protein HtpG OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=htpG PE=3 SV=1 3 671 5.0E-149
sp|Q6LTE2|HTPG_PHOPR Chaperone protein HtpG OS=Photobacterium profundum GN=htpG PE=3 SV=1 3 671 1.0E-148
sp|Q7MMR7|HTPG_VIBVY Chaperone protein HtpG OS=Vibrio vulnificus (strain YJ016) GN=htpG PE=3 SV=2 3 674 1.0E-148
sp|Q66DP8|HTPG_YERPS Chaperone protein HtpG OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=htpG PE=3 SV=1 3 671 2.0E-148
sp|A4TPA5|HTPG_YERPP Chaperone protein HtpG OS=Yersinia pestis (strain Pestoides F) GN=htpG PE=3 SV=1 3 671 2.0E-148
sp|Q1CL28|HTPG_YERPN Chaperone protein HtpG OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=htpG PE=3 SV=1 3 671 2.0E-148
sp|Q1C4P8|HTPG_YERPA Chaperone protein HtpG OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=htpG PE=3 SV=1 3 671 2.0E-148
sp|P58482|HTPG_YERPE Chaperone protein HtpG OS=Yersinia pestis GN=htpG PE=3 SV=1 3 671 2.0E-148
sp|Q1LKE3|HTPG_CUPMC Chaperone protein HtpG OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=htpG PE=3 SV=1 3 671 3.0E-148
sp|A1S564|HTPG_SHEAM Chaperone protein HtpG OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=htpG PE=3 SV=1 3 671 5.0E-148
sp|A1T639|HTPG_MYCVP Chaperone protein HtpG OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=htpG PE=3 SV=1 3 664 6.0E-148
sp|Q12PB2|HTPG_SHEDO Chaperone protein HtpG OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=htpG PE=3 SV=1 3 671 1.0E-147
sp|Q084C6|HTPG_SHEFN Chaperone protein HtpG OS=Shewanella frigidimarina (strain NCIMB 400) GN=htpG PE=3 SV=1 3 629 2.0E-147
sp|A1JNB3|HTPG_YERE8 Chaperone protein HtpG OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=htpG PE=3 SV=1 3 671 2.0E-147
sp|Q21IX0|HTPG_SACD2 Chaperone protein HtpG OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=htpG PE=3 SV=1 3 671 3.0E-147
sp|Q8DFM0|HTPG_VIBVU Chaperone protein HtpG OS=Vibrio vulnificus (strain CMCP6) GN=htpG PE=3 SV=1 3 674 4.0E-147
sp|Q8Y0Q3|HTPG_RALSO Chaperone protein HtpG OS=Ralstonia solanacearum (strain GMI1000) GN=htpG PE=3 SV=1 3 671 6.0E-147
sp|A6T5N6|HTPG_KLEP7 Chaperone protein HtpG OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=htpG PE=3 SV=1 3 671 1.0E-146
sp|O33012|HTPG_MYCLE Chaperone protein HtpG OS=Mycobacterium leprae (strain TN) GN=htpG PE=3 SV=1 3 671 2.0E-146
sp|Q6D7Z6|HTPG_PECAS Chaperone protein HtpG OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=htpG PE=3 SV=2 3 671 2.0E-146
sp|Q5PFK7|HTPG_SALPA Chaperone protein HtpG OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=htpG PE=3 SV=2 3 671 3.0E-146
sp|A9MW88|HTPG_SALPB Chaperone protein HtpG OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=htpG PE=3 SV=1 3 671 3.0E-146
sp|Q5Z3N4|HTPG_NOCFA Chaperone protein HtpG OS=Nocardia farcinica (strain IFM 10152) GN=htpG PE=3 SV=1 2 664 4.0E-146
sp|Q3Z4S6|HTPG_SHISS Chaperone protein HtpG OS=Shigella sonnei (strain Ss046) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|Q325C3|HTPG_SHIBS Chaperone protein HtpG OS=Shigella boydii serotype 4 (strain Sb227) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|P0A6Z3|HTPG_ECOLI Chaperone protein HtpG OS=Escherichia coli (strain K12) GN=htpG PE=1 SV=1 3 671 4.0E-146
sp|B1IZC1|HTPG_ECOLC Chaperone protein HtpG OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|P0A6Z4|HTPG_ECOL6 Chaperone protein HtpG OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|Q0TKG8|HTPG_ECOL5 Chaperone protein HtpG OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|A7ZXD1|HTPG_ECOHS Chaperone protein HtpG OS=Escherichia coli O9:H4 (strain HS) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|P0A6Z5|HTPG_ECO57 Chaperone protein HtpG OS=Escherichia coli O157:H7 GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|Q12FW8|HTPG_POLSJ Chaperone protein HtpG OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=htpG PE=3 SV=1 3 671 4.0E-146
sp|A7ZIN3|HTPG_ECO24 Chaperone protein HtpG OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=htpG PE=3 SV=1 3 671 6.0E-146
sp|Q15RT6|HTPG_PSEA6 Chaperone protein HtpG OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=htpG PE=3 SV=1 3 677 6.0E-146
sp|Q39SQ3|HTPG_GEOMG Chaperone protein HtpG OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=htpG PE=3 SV=1 4 671 7.0E-146
sp|P58479|HTPG_SALTI Chaperone protein HtpG OS=Salmonella typhi GN=htpG PE=3 SV=1 3 671 2.0E-145
sp|Q47XA7|HTPG_COLP3 Chaperone protein HtpG OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=htpG PE=3 SV=1 7 671 2.0E-145
sp|Q1RF62|HTPG_ECOUT Chaperone protein HtpG OS=Escherichia coli (strain UTI89 / UPEC) GN=htpG PE=3 SV=1 3 671 3.0E-145
sp|A1A8D9|HTPG_ECOK1 Chaperone protein HtpG OS=Escherichia coli O1:K1 / APEC GN=htpG PE=3 SV=1 3 671 3.0E-145
sp|Q83SE6|HTPG_SHIFL Chaperone protein HtpG OS=Shigella flexneri GN=htpG PE=3 SV=1 3 671 4.0E-145
sp|A4W7F7|HTPG_ENT38 Chaperone protein HtpG OS=Enterobacter sp. (strain 638) GN=htpG PE=3 SV=1 3 671 4.0E-145
sp|P58480|HTPG_SALTY Chaperone protein HtpG OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=htpG PE=3 SV=1 3 671 4.0E-145
sp|A9NB44|HTPG_COXBR Chaperone protein HtpG OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=htpG PE=3 SV=1 2 671 8.0E-145
sp|Q57S77|HTPG_SALCH Chaperone protein HtpG OS=Salmonella choleraesuis (strain SC-B67) GN=htpG PE=3 SV=2 3 671 9.0E-145
sp|A4IZQ6|HTPG_FRATW Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=htpG PE=3 SV=1 5 672 1.0E-144
sp|Q83EL0|HTPG_COXBU Chaperone protein HtpG OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=htpG PE=1 SV=1 2 671 1.0E-144
sp|A1VTA5|HTPG_POLNA Chaperone protein HtpG OS=Polaromonas naphthalenivorans (strain CJ2) GN=htpG PE=3 SV=1 3 671 1.0E-144
sp|P9WMJ7|HTPG_MYCTU Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=htpG PE=1 SV=1 3 665 1.0E-144
sp|P9WMJ6|HTPG_MYCTO Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=htpG PE=3 SV=1 3 665 1.0E-144
sp|A5U4Y2|HTPG_MYCTA Chaperone protein HtpG OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=htpG PE=3 SV=1 3 665 1.0E-144
sp|A1KKZ1|HTPG_MYCBP Chaperone protein HtpG OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=htpG PE=3 SV=1 3 665 1.0E-144
sp|P64412|HTPG_MYCBO Chaperone protein HtpG OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=htpG PE=3 SV=1 3 665 1.0E-144
sp|Q32J53|HTPG_SHIDS Chaperone protein HtpG OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=htpG PE=3 SV=1 3 671 2.0E-144
sp|A0PRT4|HTPG_MYCUA Chaperone protein HtpG OS=Mycobacterium ulcerans (strain Agy99) GN=htpG PE=3 SV=1 3 665 2.0E-144
sp|B6EHJ9|HTPG_ALISL Chaperone protein HtpG OS=Aliivibrio salmonicida (strain LFI1238) GN=htpG PE=3 SV=1 3 671 2.0E-144
sp|Q2VZ28|HTPG_MAGSA Chaperone protein HtpG OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=htpG PE=3 SV=2 3 675 2.0E-144
sp|A8AJX0|HTPG_CITK8 Chaperone protein HtpG OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=htpG PE=3 SV=1 3 671 4.0E-144
sp|Q0HU95|HTPG_SHESR Chaperone protein HtpG OS=Shewanella sp. (strain MR-7) GN=htpG PE=3 SV=1 3 671 4.0E-144
sp|A0Q4L0|HTPG_FRATN Chaperone protein HtpG OS=Francisella tularensis subsp. novicida (strain U112) GN=htpG PE=3 SV=1 5 672 5.0E-144
sp|A6VML2|HTPG_ACTSZ Chaperone protein HtpG OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=htpG PE=3 SV=1 3 671 5.0E-144
sp|A0KY03|HTPG_SHESA Chaperone protein HtpG OS=Shewanella sp. (strain ANA-3) GN=htpG PE=3 SV=1 3 671 1.0E-143
sp|A9KGQ8|HTPG_COXBN Chaperone protein HtpG OS=Coxiella burnetii (strain Dugway 5J108-111) GN=htpG PE=3 SV=1 2 671 1.0E-143
sp|Q31F72|HTPG_THICR Chaperone protein HtpG OS=Thiomicrospira crunogena (strain XCL-2) GN=htpG PE=3 SV=1 3 671 2.0E-143
sp|Q5NHT8|HTPG_FRATT Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=htpG PE=3 SV=1 5 672 2.0E-143
sp|Q14J90|HTPG_FRAT1 Chaperone protein HtpG OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=htpG PE=3 SV=1 5 672 2.0E-143
sp|Q2A5E0|HTPG_FRATH Chaperone protein HtpG OS=Francisella tularensis subsp. holarctica (strain LVS) GN=htpG PE=3 SV=1 5 672 3.0E-143
sp|A7N9V7|HTPG_FRATF Chaperone protein HtpG OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=htpG PE=3 SV=1 5 672 3.0E-143
sp|Q0HHZ5|HTPG_SHESM Chaperone protein HtpG OS=Shewanella sp. (strain MR-4) GN=htpG PE=3 SV=1 3 671 3.0E-143
sp|B0U0M7|HTPG_FRAP2 Chaperone protein HtpG OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=htpG PE=3 SV=1 5 672 4.0E-143
sp|Q65RV7|HTPG_MANSM Chaperone protein HtpG OS=Mannheimia succiniciproducens (strain MBEL55E) GN=htpG PE=3 SV=1 3 671 6.0E-143
sp|Q6FF82|HTPG_ACIAD Chaperone protein HtpG OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=htpG PE=3 SV=1 3 671 6.0E-143
sp|A4Y7T7|HTPG_SHEPC Chaperone protein HtpG OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=htpG PE=3 SV=1 3 671 6.0E-143
sp|A9L569|HTPG_SHEB9 Chaperone protein HtpG OS=Shewanella baltica (strain OS195) GN=htpG PE=3 SV=1 3 671 7.0E-143
sp|A6WPI2|HTPG_SHEB8 Chaperone protein HtpG OS=Shewanella baltica (strain OS185) GN=htpG PE=3 SV=1 3 671 7.0E-143
sp|A3D5M8|HTPG_SHEB5 Chaperone protein HtpG OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=htpG PE=3 SV=1 3 671 1.0E-142
sp|Q2NV58|HTPG_SODGM Chaperone protein HtpG OS=Sodalis glossinidius (strain morsitans) GN=htpG PE=3 SV=2 3 671 1.0E-142
sp|Q2JGG1|HTPG_FRASC Chaperone protein HtpG OS=Frankia sp. (strain CcI3) GN=htpG PE=3 SV=1 3 667 1.0E-142
sp|A1W3A1|HTPG_ACISJ Chaperone protein HtpG OS=Acidovorax sp. (strain JS42) GN=htpG PE=3 SV=1 3 671 2.0E-142
sp|Q8EFF7|HTPG_SHEON Chaperone protein HtpG OS=Shewanella oneidensis (strain MR-1) GN=htpG PE=3 SV=1 3 671 2.0E-142
sp|Q87RH5|HTPG_VIBPA Chaperone protein HtpG OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=htpG PE=3 SV=1 3 671 4.0E-142
sp|A1STI2|HTPG_PSYIN Chaperone protein HtpG OS=Psychromonas ingrahamii (strain 37) GN=htpG PE=3 SV=1 7 671 1.0E-141
sp|A1RIQ1|HTPG_SHESW Chaperone protein HtpG OS=Shewanella sp. (strain W3-18-1) GN=htpG PE=3 SV=1 3 671 1.0E-141
sp|A8GAV2|HTPG_SERP5 Chaperone protein HtpG OS=Serratia proteamaculans (strain 568) GN=htpG PE=3 SV=1 3 671 3.0E-141
sp|Q60AK3|HTPG_METCA Chaperone protein HtpG OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=htpG PE=3 SV=1 4 672 4.0E-141
sp|P61184|HTPG_BDEBA Chaperone protein HtpG OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=htpG PE=3 SV=1 7 671 5.0E-141
sp|A4X7S0|HTPG_SALTO Chaperone protein HtpG OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=htpG PE=3 SV=1 2 669 8.0E-141
sp|A2SKM5|HTPG_METPP Chaperone protein HtpG OS=Methylibium petroleiphilum (strain PM1) GN=htpG PE=3 SV=1 3 671 1.0E-140
sp|A7N178|HTPG_VIBCB Chaperone protein HtpG OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=htpG PE=3 SV=1 3 671 2.0E-140
sp|Q14568|HS902_HUMAN Heat shock protein HSP 90-alpha A2 OS=Homo sapiens GN=HSP90AA2P PE=1 SV=2 2 323 3.0E-140
sp|A8M4S6|HTPG_SALAI Chaperone protein HtpG OS=Salinispora arenicola (strain CNS-205) GN=htpG PE=3 SV=1 2 669 5.0E-140
sp|A6VXW3|HTPG_MARMS Chaperone protein HtpG OS=Marinomonas sp. (strain MWYL1) GN=htpG PE=3 SV=1 3 671 8.0E-140
sp|C3LTN3|HTPG_VIBCM Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain M66-2) GN=htpG PE=3 SV=1 3 671 3.0E-139
sp|P22359|HTPG_VIBCH Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=htpG PE=2 SV=2 3 671 3.0E-139
sp|A5F2T9|HTPG_VIBC3 Chaperone protein HtpG OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=htpG PE=3 SV=1 3 671 3.0E-139
sp|B7VII6|HTPG_VIBTL Chaperone protein HtpG OS=Vibrio tasmaniensis (strain LGP32) GN=htpG PE=3 SV=1 3 671 1.0E-138
sp|Q5E6Q9|HTPG_VIBF1 Chaperone protein HtpG OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=htpG PE=3 SV=1 3 671 5.0E-138
sp|Q4FQZ1|HTPG_PSYA2 Chaperone protein HtpG OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=htpG PE=3 SV=1 7 671 6.0E-138
sp|A5CWV5|HTPG_VESOH Chaperone protein HtpG OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=htpG PE=3 SV=1 1 671 1.0E-137
sp|Q0VPG1|HTPG_ALCBS Chaperone protein HtpG OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=htpG PE=3 SV=1 3 671 1.0E-137
sp|A1AWE2|HTPG_RUTMC Chaperone protein HtpG OS=Ruthia magnifica subsp. Calyptogena magnifica GN=htpG PE=3 SV=1 7 671 1.0E-137
sp|A0L8B0|HTPG_MAGMM Chaperone protein HtpG OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=htpG PE=3 SV=1 3 671 3.0E-137
sp|P58481|HTPG_STRCO Chaperone protein HtpG OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=htpG PE=3 SV=1 3 665 6.0E-137
sp|Q21SJ8|HTPG_RHOFT Chaperone protein HtpG OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=htpG PE=3 SV=1 3 671 6.0E-137
sp|Q07GW8|HTPG_RHOP5 Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisA53) GN=htpG PE=3 SV=1 3 671 8.0E-137
sp|Q1Q978|HTPG_PSYCK Chaperone protein HtpG OS=Psychrobacter cryohalolentis (strain K5) GN=htpG PE=3 SV=1 7 671 1.0E-136
sp|Q5FS51|HTPG_GLUOX Chaperone protein HtpG OS=Gluconobacter oxydans (strain 621H) GN=htpG PE=3 SV=1 2 671 1.0E-136
sp|Q1LTX6|HTPG_BAUCH Chaperone protein HtpG OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=htpG PE=3 SV=1 3 671 7.0E-136
sp|Q30R39|HTPG_SULDN Chaperone protein HtpG OS=Sulfurimonas denitrificans (strain ATCC 33889 / DSM 1251) GN=htpG PE=3 SV=1 6 671 2.0E-135
sp|P61189|HTPG_WOLPM Chaperone protein HtpG OS=Wolbachia pipientis wMel GN=htpG PE=3 SV=1 2 671 2.0E-135
sp|Q2RYB8|HTPG_RHORT Chaperone protein HtpG OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=htpG PE=3 SV=1 3 675 2.0E-135
sp|P57555|HTPG_BUCAI Chaperone protein HtpG OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=htpG PE=3 SV=1 3 671 1.0E-134
sp|A1WF62|HTPG_VEREI Chaperone protein HtpG OS=Verminephrobacter eiseniae (strain EF01-2) GN=htpG PE=3 SV=1 3 671 6.0E-134
sp|Q89CK8|HTPG_BRADU Chaperone protein HtpG OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=htpG PE=3 SV=1 3 676 7.0E-134
sp|P56116|HTPG_HELPY Chaperone protein HtpG OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=htpG PE=3 SV=1 5 671 2.0E-133
sp|O83949|HTPG_TREPA Chaperone protein HtpG OS=Treponema pallidum (strain Nichols) GN=htpG PE=3 SV=1 1 674 4.0E-133
sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens GN=HSP90AB3P PE=5 SV=1 4 391 4.0E-132
sp|Q5HBT2|HTPG_EHRRW Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Welgevonden) GN=htpG PE=3 SV=1 2 671 8.0E-132
sp|Q2IQY5|HTPG_RHOP2 Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain HaA2) GN=htpG PE=3 SV=1 2 675 1.0E-131
sp|Q5GTE5|HTPG_WOLTR Chaperone protein HtpG OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=htpG PE=3 SV=1 2 671 5.0E-131
sp|Q5FHC4|HTPG_EHRRG Chaperone protein HtpG OS=Ehrlichia ruminantium (strain Gardel) GN=htpG PE=3 SV=1 2 671 1.0E-130
sp|Q1CUU4|HTPG_HELPH Chaperone protein HtpG OS=Helicobacter pylori (strain HPAG1) GN=htpG PE=3 SV=1 5 671 3.0E-130
sp|Q9ZMM2|HTPG_HELPJ Chaperone protein HtpG OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=htpG PE=3 SV=1 5 671 3.0E-130
sp|P46208|HTPG_BACSU Chaperone protein HtpG OS=Bacillus subtilis (strain 168) GN=htpG PE=3 SV=1 6 671 5.0E-130
sp|A8F060|HTPG_RICCK Chaperone protein HtpG OS=Rickettsia canadensis (strain McKiel) GN=htpG PE=3 SV=1 6 672 2.0E-129
sp|Q17VU7|HTPG_HELAH Chaperone protein HtpG OS=Helicobacter acinonychis (strain Sheeba) GN=htpG PE=3 SV=1 5 671 5.0E-129
sp|P61187|HTPG_RHOPA Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=htpG PE=3 SV=1 2 675 6.0E-129
sp|B2A875|HTPG_NATTJ Chaperone protein HtpG OS=Natranaerobius thermophilus (strain ATCC BAA-1301 / DSM 18059 / JW/NM-WN-LF) GN=htpG PE=3 SV=1 4 671 7.0E-129
sp|Q20WN5|HTPG_RHOPB Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisB18) GN=htpG PE=3 SV=1 7 671 9.0E-129
sp|Q7M8C4|HTPG_WOLSU Chaperone protein HtpG OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=htpG PE=3 SV=1 7 672 9.0E-129
sp|A7GEU9|HTPG_CLOBL Chaperone protein HtpG OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=htpG PE=3 SV=1 3 672 1.0E-128
sp|B1IN79|HTPG_CLOBK Chaperone protein HtpG OS=Clostridium botulinum (strain Okra / Type B1) GN=htpG PE=3 SV=1 3 672 1.0E-128
sp|Q8K981|HTPG_BUCAP Chaperone protein HtpG OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=htpG PE=3 SV=1 3 671 2.0E-128
sp|C1FPN9|HTPG_CLOBJ Chaperone protein HtpG OS=Clostridium botulinum (strain Kyoto / Type A2) GN=htpG PE=3 SV=1 3 672 2.0E-128
sp|B1KUN4|HTPG_CLOBM Chaperone protein HtpG OS=Clostridium botulinum (strain Loch Maree / Type A3) GN=htpG PE=3 SV=1 3 672 4.0E-128
sp|C3KXP4|HTPG_CLOB6 Chaperone protein HtpG OS=Clostridium botulinum (strain 657 / Type Ba4) GN=htpG PE=3 SV=1 3 672 5.0E-128
sp|A7ZAI5|HTPG_BACMF Chaperone protein HtpG OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=htpG PE=3 SV=1 7 671 9.0E-128
sp|Q68Y08|HTPG_RICTY Chaperone protein HtpG OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=htpG PE=3 SV=1 6 672 1.0E-127
sp|A8HVS4|HTPG_AZOC5 Chaperone protein HtpG OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=htpG PE=3 SV=1 3 675 1.0E-127
sp|Q3SNS6|HTPG_NITWN Chaperone protein HtpG OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=htpG PE=3 SV=1 2 676 2.0E-127
sp|A5I3B0|HTPG_CLOBH Chaperone protein HtpG OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=htpG PE=3 SV=1 3 672 3.0E-127
sp|A7FV42|HTPG_CLOB1 Chaperone protein HtpG OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=htpG PE=3 SV=1 3 672 3.0E-127
sp|Q1RIV1|HTPG_RICBR Chaperone protein HtpG OS=Rickettsia bellii (strain RML369-C) GN=htpG PE=3 SV=1 6 672 5.0E-127
sp|A8GQ51|HTPG_RICAH Chaperone protein HtpG OS=Rickettsia akari (strain Hartford) GN=htpG PE=3 SV=1 6 672 5.0E-127
sp|A8GWJ4|HTPG_RICB8 Chaperone protein HtpG OS=Rickettsia bellii (strain OSU 85-389) GN=htpG PE=3 SV=1 6 672 1.0E-126
sp|B1LZG0|HTPG_METRJ Chaperone protein HtpG OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=htpG PE=3 SV=1 3 631 2.0E-126
sp|A8GTZ5|HTPG_RICRS Chaperone protein HtpG OS=Rickettsia rickettsii (strain Sheila Smith) GN=htpG PE=3 SV=1 6 672 2.0E-126
sp|B0BVI6|HTPG_RICRO Chaperone protein HtpG OS=Rickettsia rickettsii (strain Iowa) GN=htpG PE=3 SV=1 6 672 2.0E-126
sp|Q12ZX1|HTPG_RHOPS Chaperone protein HtpG OS=Rhodopseudomonas palustris (strain BisB5) GN=htpG PE=3 SV=1 2 675 4.0E-126
sp|Q9KE51|HTPG_BACHD Chaperone protein HtpG OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=htpG PE=3 SV=1 6 671 8.0E-126
sp|P58478|HTPG_RICCN Chaperone protein HtpG OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=htpG PE=3 SV=1 6 672 8.0E-126
sp|Q3B3E6|HTPG_CHLL7 Chaperone protein HtpG OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=htpG PE=3 SV=1 5 672 9.0E-126
sp|Q1QHD7|HTPG_NITHX Chaperone protein HtpG OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=htpG PE=3 SV=1 2 676 1.0E-125
sp|A8EV23|HTPG_ARCB4 Chaperone protein HtpG OS=Arcobacter butzleri (strain RM4018) GN=htpG PE=3 SV=1 6 675 1.0E-125
sp|Q98JB6|HTPG_RHILO Chaperone protein HtpG OS=Rhizobium loti (strain MAFF303099) GN=htpG PE=3 SV=1 3 675 2.0E-125
sp|Q3YSL9|HTPG_EHRCJ Chaperone protein HtpG OS=Ehrlichia canis (strain Jake) GN=htpG PE=3 SV=1 2 671 2.0E-125
sp|Q7VFD7|HTPG_HELHP Chaperone protein HtpG OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=htpG PE=3 SV=1 1 671 3.0E-125
sp|A8MGJ3|HTPG_ALKOO Chaperone protein HtpG OS=Alkaliphilus oremlandii (strain OhILAs) GN=htpG PE=3 SV=1 3 671 3.0E-125
sp|Q89A93|HTPG_BUCBP Chaperone protein HtpG OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=htpG PE=3 SV=1 3 671 3.0E-125
sp|Q4UJV5|HTPG_RICFE Chaperone protein HtpG OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=htpG PE=3 SV=1 6 672 8.0E-125
sp|A8F2Y0|HTPG_RICM5 Chaperone protein HtpG OS=Rickettsia massiliae (strain Mtu5) GN=htpG PE=3 SV=1 6 672 1.0E-124
sp|Q5WJE6|HTPG_BACSK Chaperone protein HtpG OS=Bacillus clausii (strain KSM-K16) GN=htpG PE=3 SV=1 6 671 1.0E-124
sp|Q2GFY5|HTPG_EHRCR Chaperone protein HtpG OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=htpG PE=3 SV=1 2 671 3.0E-124
sp|Q8CX68|HTPG_OCEIH Chaperone protein HtpG OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=htpG PE=3 SV=1 6 671 3.0E-124
sp|Q0SVV8|HTPG_CLOPS Chaperone protein HtpG OS=Clostridium perfringens (strain SM101 / Type A) GN=htpG PE=3 SV=1 6 672 6.0E-124
sp|A1BFP7|HTPG_CHLPD Chaperone protein HtpG OS=Chlorobium phaeobacteroides (strain DSM 266) GN=htpG PE=3 SV=1 5 672 8.0E-124
sp|Q0TU16|HTPG_CLOP1 Chaperone protein HtpG OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=htpG PE=3 SV=1 6 672 2.0E-123
sp|B8IU50|HTPG_METNO Chaperone protein HtpG OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=htpG PE=3 SV=1 1 667 2.0E-123
sp|Q8XNC2|HTPG_CLOPE Chaperone protein HtpG OS=Clostridium perfringens (strain 13 / Type A) GN=htpG PE=3 SV=1 6 672 3.0E-123
sp|Q9ZCB9|HTPG_RICPR Chaperone protein HtpG OS=Rickettsia prowazekii (strain Madrid E) GN=htpG PE=3 SV=1 6 672 8.0E-123
sp|Q8KE61|HTPG_CHLTE Chaperone protein HtpG OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=htpG PE=3 SV=1 5 672 4.0E-122
sp|Q8D228|HTPG_WIGBR Chaperone protein HtpG OS=Wigglesworthia glossinidia brevipalpis GN=htpG PE=3 SV=1 3 671 9.0E-122
sp|B1Z9Y8|HTPG_METPB Chaperone protein HtpG OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=htpG PE=3 SV=1 3 660 2.0E-121
sp|B0UN89|HTPG_METS4 Chaperone protein HtpG OS=Methylobacterium sp. (strain 4-46) GN=htpG PE=3 SV=1 1 644 3.0E-121
sp|Q2GJI3|HTPG_ANAPZ Chaperone protein HtpG OS=Anaplasma phagocytophilum (strain HZ) GN=htpG PE=3 SV=1 3 671 5.0E-121
sp|Q660W4|HTPG_BORBP Chaperone protein HtpG OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=htpG PE=3 SV=1 6 672 6.0E-121
sp|A9W1H7|HTPG_METEP Chaperone protein HtpG OS=Methylobacterium extorquens (strain PA1) GN=htpG PE=3 SV=1 3 660 2.0E-120
sp|Q5PB86|HTPG_ANAMM Chaperone protein HtpG OS=Anaplasma marginale (strain St. Maries) GN=htpG PE=3 SV=1 2 671 2.0E-120
sp|Q9PHZ3|HTPG_CAMJE Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=htpG PE=3 SV=1 6 671 6.0E-120
sp|Q5HVP5|HTPG_CAMJR Chaperone protein HtpG OS=Campylobacter jejuni (strain RM1221) GN=htpG PE=3 SV=1 6 671 8.0E-120
sp|A7H4M0|HTPG_CAMJD Chaperone protein HtpG OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=htpG PE=3 SV=1 6 671 1.0E-119
sp|A1VYN0|HTPG_CAMJJ Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=htpG PE=3 SV=1 6 671 1.0E-119
sp|A8FKU4|HTPG_CAMJ8 Chaperone protein HtpG OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=htpG PE=3 SV=1 6 671 1.0E-119
sp|P42555|HTPG_BORBU Chaperone protein HtpG OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=htpG PE=3 SV=2 6 672 2.0E-119
sp|B7KPG0|HTPG_METC4 Chaperone protein HtpG OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=htpG PE=3 SV=1 3 660 2.0E-119
sp|B1YG43|HTPG_EXIS2 Chaperone protein HtpG OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=htpG PE=3 SV=1 3 671 3.0E-119
sp|Q894P6|HTPG_CLOTE Chaperone protein HtpG OS=Clostridium tetani (strain Massachusetts / E88) GN=htpG PE=3 SV=2 6 672 5.0E-119
sp|Q0SMU9|HTPG_BORAP Chaperone protein HtpG OS=Borrelia afzelii (strain PKo) GN=htpG PE=3 SV=1 6 672 7.0E-119
sp|Q97E05|HTPG_CLOAB Chaperone protein HtpG OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=htpG PE=3 SV=1 6 672 4.0E-118
sp|Q65CZ5|HTPG_BACLD Chaperone protein HtpG OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=htpG PE=3 SV=1 6 671 3.0E-117
sp|A7I226|HTPG_CAMHC Chaperone protein HtpG OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=htpG PE=3 SV=1 6 671 1.0E-116
sp|P58477|HTPG_RHIME Chaperone protein HtpG OS=Rhizobium meliloti (strain 1021) GN=htpG PE=3 SV=1 7 675 7.0E-114
sp|A6QBI2|HTPG_SULNB Chaperone protein HtpG OS=Sulfurovum sp. (strain NBC37-1) GN=htpG PE=3 SV=1 6 675 8.0E-114
sp|Q3ARP2|HTPG_CHLCH Chaperone protein HtpG OS=Chlorobium chlorochromatii (strain CaD3) GN=htpG PE=3 SV=1 5 672 6.0E-113
sp|A6TKN0|HTPG_ALKMQ Chaperone protein HtpG OS=Alkaliphilus metalliredigens (strain QYMF) GN=htpG PE=3 SV=1 6 671 9.0E-113
sp|Q728G0|HTPG_DESVH Chaperone protein HtpG OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=htpG PE=3 SV=1 7 672 6.0E-112
sp|Q2JZH2|HTPG_RHIEC Chaperone protein HtpG OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=htpG PE=3 SV=1 2 678 4.0E-110
sp|O16087|HSP83_DROMI Heat shock protein 83 (Fragment) OS=Drosophila miranda GN=Hsp83 PE=3 SV=1 2 216 2.0E-109
sp|Q313E8|HTPG_DESAG Chaperone protein HtpG OS=Desulfovibrio alaskensis (strain G20) GN=htpG PE=3 SV=1 2 672 3.0E-109
sp|Q2GDR7|HTPG_NEOSM Chaperone protein HtpG OS=Neorickettsia sennetsu (strain Miyayama) GN=htpG PE=3 SV=1 4 673 7.0E-109
sp|Q057D9|HTPG_BUCCC Chaperone protein HtpG OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=htpG PE=3 SV=1 4 670 5.0E-108
sp|A5CCZ2|HTPG_ORITB Chaperone protein HtpG OS=Orientia tsutsugamushi (strain Boryong) GN=htpG PE=3 SV=1 2 676 2.0E-106
sp|Q12931|TRAP1_HUMAN Heat shock protein 75 kDa, mitochondrial OS=Homo sapiens GN=TRAP1 PE=1 SV=3 6 671 7.0E-106
sp|P08712|ENPL_MESAU Endoplasmin (Fragment) OS=Mesocricetus auratus GN=HSP90B1 PE=1 SV=1 335 678 1.0E-105
sp|O16076|HSP83_DROPE Heat shock protein 83 (Fragment) OS=Drosophila persimilis GN=Hsp83 PE=3 SV=1 2 216 9.0E-105
sp|P54650|HTPG_ALIFS Chaperone protein HtpG (Fragment) OS=Aliivibrio fischeri GN=htpG PE=3 SV=1 3 427 1.0E-100
sp|O16068|HSP83_DROPB Heat shock protein 83 (Fragment) OS=Drosophila pseudoobscura bogotana GN=Hsp83 PE=3 SV=1 2 216 3.0E-97
sp|A1TZH7|HTPG_MARHV Chaperone protein HtpG OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=htpG PE=3 SV=1 269 671 4.0E-86
sp|Q58FF3|ENPLL_HUMAN Putative endoplasmin-like protein OS=Homo sapiens GN=HSP90B2P PE=5 SV=1 284 638 5.0E-84
sp|P35016|ENPL_CATRO Endoplasmin homolog OS=Catharanthus roseus GN=HSP90 PE=2 SV=1 2 210 3.0E-79
sp|Q162C5|HTPG_ROSDO Chaperone protein HtpG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=htpG PE=3 SV=1 262 675 5.0E-75
sp|A4SEX9|HTPG_CHLPM Chaperone protein HtpG OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=htpG PE=3 SV=1 266 672 3.0E-73
sp|Q6ARM0|HTPG_DESPS Chaperone protein HtpG OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=htpG PE=3 SV=1 263 671 2.0E-68
sp|Q4R520|ENPL_MACFA Endoplasmin OS=Macaca fascicularis GN=HSP90B1 PE=2 SV=1 2 210 1.0E-63
sp|P14625|ENPL_HUMAN Endoplasmin OS=Homo sapiens GN=HSP90B1 PE=1 SV=1 2 210 2.0E-63
sp|Q29092|ENPL_PIG Endoplasmin OS=Sus scrofa GN=HSP90B1 PE=2 SV=3 2 210 4.0E-63
sp|Q5R6F7|ENPL_PONAB Endoplasmin OS=Pongo abelii GN=HSP90B1 PE=2 SV=1 2 210 2.0E-62
sp|Q24VT7|HTPG_DESHY Chaperone protein HtpG OS=Desulfitobacterium hafniense (strain Y51) GN=htpG PE=3 SV=1 264 675 2.0E-62
sp|Q8RGH4|HTPG_FUSNN Chaperone protein HtpG OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=htpG PE=3 SV=1 218 672 5.0E-61
sp|Q58FF7|H90B3_HUMAN Putative heat shock protein HSP 90-beta-3 OS=Homo sapiens GN=HSP90AB3P PE=5 SV=1 442 709 4.0E-60
sp|Q162C5|HTPG_ROSDO Chaperone protein HtpG OS=Roseobacter denitrificans (strain ATCC 33942 / OCh 114) GN=htpG PE=3 SV=1 3 206 4.0E-59
sp|Q5XHZ0|TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus GN=Trap1 PE=1 SV=1 269 671 1.0E-58
sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus GN=Trap1 PE=1 SV=1 269 671 1.0E-57
sp|Q24VT7|HTPG_DESHY Chaperone protein HtpG OS=Desulfitobacterium hafniense (strain Y51) GN=htpG PE=3 SV=1 3 206 2.0E-55
sp|Q2TBI4|TRAP1_BOVIN Heat shock protein 75 kDa, mitochondrial OS=Bos taurus GN=TRAP1 PE=2 SV=1 269 671 2.0E-55
sp|P20147|HSP90_PLAFP Heat shock 90 kDa protein homolog (Fragment) OS=Plasmodium falciparum (isolate Palo Alto / Uganda) PE=2 SV=1 513 709 8.0E-55
sp|Q8A9B8|HTPG_BACTN Chaperone protein HtpG OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=htpG PE=3 SV=1 14 605 1.0E-54
sp|P0C938|HTPG_PORGI Chaperone protein HtpG OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=htpG PE=3 SV=1 14 514 3.0E-54
sp|B2RGR5|HTPG_PORG3 Chaperone protein HtpG OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=htpG PE=3 SV=1 14 514 1.0E-53
sp|P0CJ84|HTPG_BACFR Chaperone protein htpG OS=Bacteroides fragilis (strain YCH46) GN=htpG PE=3 SV=1 14 633 2.0E-52
sp|Q5LCH4|HTPG_BACFN Chaperone protein HtpG OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=htpG PE=3 SV=1 14 633 2.0E-52
sp|A1TZH7|HTPG_MARHV Chaperone protein HtpG OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=htpG PE=3 SV=1 3 206 3.0E-52
sp|E1WNR6|HTPG_BACF6 Chaperone protein htpG OS=Bacteroides fragilis (strain 638R) GN=htpG PE=3 SV=1 14 633 6.0E-52
sp|Q5XHZ0|TRAP1_RAT Heat shock protein 75 kDa, mitochondrial OS=Rattus norvegicus GN=Trap1 PE=1 SV=1 6 207 1.0E-51
sp|Q9CQN1|TRAP1_MOUSE Heat shock protein 75 kDa, mitochondrial OS=Mus musculus GN=Trap1 PE=1 SV=1 6 207 5.0E-50
sp|Q2TBI4|TRAP1_BOVIN Heat shock protein 75 kDa, mitochondrial OS=Bos taurus GN=TRAP1 PE=2 SV=1 2 207 7.0E-50
sp|Q6ARM0|HTPG_DESPS Chaperone protein HtpG OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=htpG PE=3 SV=1 2 206 5.0E-49
sp|Q8RGH4|HTPG_FUSNN Chaperone protein HtpG OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=htpG PE=3 SV=1 7 206 1.0E-48
sp|Q86L04|TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=trap1 PE=2 SV=1 269 671 3.0E-47
sp|A4SEX9|HTPG_CHLPM Chaperone protein HtpG OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=htpG PE=3 SV=1 5 206 7.0E-45
sp|Q86L04|TRAP1_DICDI TNF receptor-associated protein 1 homolog, mitochondrial OS=Dictyostelium discoideum GN=trap1 PE=2 SV=1 1 209 4.0E-44
sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1 48 155 5.0E-44
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 2 137 1.0E-42
sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1 287 406 4.0E-36
sp|Q58FG1|HS904_HUMAN Putative heat shock protein HSP 90-alpha A4 OS=Homo sapiens GN=HSP90AA4P PE=5 SV=1 481 702 8.0E-34
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 455 594 2.0E-28
sp|Q58FF8|H90B2_HUMAN Putative heat shock protein HSP 90-beta 2 OS=Homo sapiens GN=HSP90AB2P PE=1 SV=2 179 311 1.0E-27
sp|Q58FG0|HS905_HUMAN Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens GN=HSP90AA5P PE=2 SV=1 178 315 3.0E-27
sp|Q58FG0|HS905_HUMAN Putative heat shock protein HSP 90-alpha A5 OS=Homo sapiens GN=HSP90AA5P PE=2 SV=1 452 525 7.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016887 ATP hydrolysis activity Yes
GO:0051082 unfolded protein binding Yes
GO:0005524 ATP binding Yes
GO:0006457 protein folding Yes
GO:0008150 biological_process No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0003674 molecular_function No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0000166 nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0097367 carbohydrate derivative binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0017111 nucleoside-triphosphatase activity No
GO:0003824 catalytic activity No
GO:0017076 purine nucleotide binding No
GO:0097159 organic cyclic compound binding No
GO:1901265 nucleoside phosphate binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0032555 purine ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0009987 cellular process No
GO:0005515 protein binding No
GO:0016462 pyrophosphatase activity No
GO:0030554 adenyl nucleotide binding No
GO:0043168 anion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|955
MAETFEFQAEISQLLSLIINTVYSNKEIFLRELISNASDALDKIRYKALSDPSQLDSGKDLRIDIIPNKEAKTLT
IRDTGIGMTKADLVNNLGTIARSGTKQFMEALTAGADVSMIGQFGVGFYSAYLVADRVSVISKHNDDEQYIWESS
AGGTFNITADTKGEPLGRGTAIILHLKDEQAEYLNESKIKEVIKKHSEFISYPIYLHVTKETETEVPDEDAEAEE
VKEDEGDDKKPRIEEVDDEDEEKDKEKKKKTKKIKETKIEEEELNKQKPIWTRNPQDITQEEYASFYKSLSNDWE
DPLAVKHFSVEGQLEFRAILFVPKRAPFDLFETKKTKNNIKLYVRRVFITDDATDLIPEWLGFIKGVVDSEDLPL
NLSRETLQQNKIMKVIKKNIVKKALELFTEISEDKEQFDKFYSAFSKNIKLGIHEDSQNRQVLAKLLRFNSTKSG
DEMTSLADYVTRMPEHQNNMYYITGESIKAVSKSPFLDTLKDKGFEVLFLVDPIDEYAMTQLKEFEGKKLVDITK
DFELEETEEEKKAREEEEKEYESLAKSLKNVLGEKVEKVVVSHKLGLCPCAIRTGQFGWSANMERIMKAQALRDT
SMSSYMSSKKTFEISPKSPIIQELKKKVEADGENDRTVKSIVQLLFETSLLVSGFTIDEPAGFAERIHKLVQLGL
NIEEDDNAAPTEAEAVETSAAAPAAGDSAMEEVD*
Coding >OphauB2|955
ATGGCTGAGACTTTCGAGTTCCAGGCTGAGATTTCTCAGCTGCTGTCTCTCATCATCAACACTGTCTACTCCAAC
AAGGAAATTTTCCTCAGAGAGCTCATCTCCAATGCCTCTGATGCTTTGGACAAGATTCGCTACAAGGCCTTGTCG
GATCCTAGTCAGCTTGACAGCGGCAAGGATCTGCGCATCGACATCATTCCCAACAAGGAGGCCAAGACTTTGACC
ATTCGCGACACGGGCATTGGCATGACCAAGGCTGATTTGGTCAACAATCTTGGTACCATTGCACGCTCTGGCACC
AAGCAGTTTATGGAGGCATTGACGGCTGGTGCCGATGTTTCCATGATTGGTCAATTTGGTGTTGGCTTCTACTCT
GCCTACCTTGTTGCCGACCGCGTTAGCGTCATTTCAAAGCACAATGACGACGAGCAGTACATCTGGGAGTCGAGC
GCTGGTGGCACCTTCAACATTACTGCTGATACCAAGGGTGAGCCGCTTGGCCGCGGAACCGCCATTATTCTTCAC
CTCAAGGATGAGCAGGCAGAGTACCTCAATGAGAGCAAGATCAAGGAGGTTATCAAGAAGCACTCCGAGTTTATC
TCTTACCCCATTTACCTTCACGTCACCAAGGAGACTGAGACTGAAGTCCCTGATGAGGATGCCGAGGCTGAAGAG
GTCAAGGAGGATGAGGGTGATGACAAGAAGCCCCGCATTGAAGAGGTTGACGACGAAGACGAGGAAAAGGACAAG
GAGAAGAAGAAGAAGACCAAGAAGATCAAGGAGACCAAGATTGAAGAAGAGGAGCTCAACAAGCAAAAGCCCATC
TGGACTCGCAACCCACAGGACATCACCCAGGAGGAGTATGCTTCCTTTTACAAGTCTCTCTCCAACGACTGGGAG
GACCCTCTTGCCGTCAAGCACTTCTCAGTCGAGGGACAGCTTGAATTCCGCGCCATTCTCTTCGTGCCCAAGCGC
GCACCCTTTGACTTGTTTGAGACCAAGAAGACCAAGAACAACATCAAGCTCTATGTCCGCCGCGTCTTCATTACT
GATGATGCTACTGATCTCATTCCCGAGTGGCTTGGCTTCATCAAGGGCGTTGTCGACTCTGAGGATCTCCCTCTT
AACCTGTCTCGTGAGACTCTTCAGCAAAACAAGATTATGAAGGTGATCAAGAAGAATATTGTCAAGAAGGCTCTT
GAGCTCTTCACGGAGATTTCGGAGGACAAGGAGCAGTTCGACAAGTTTTACAGTGCCTTCTCCAAGAACATCAAG
CTTGGAATCCACGAGGATTCGCAAAACCGTCAAGTCTTGGCCAAGCTTCTACGCTTCAACTCGACCAAGTCTGGC
GATGAAATGACATCGCTTGCCGACTATGTCACTCGCATGCCTGAGCACCAGAATAACATGTACTACATTACGGGC
GAGTCCATCAAGGCTGTGTCAAAGTCGCCCTTCCTTGATACGCTCAAGGACAAAGGCTTCGAGGTGTTGTTCCTG
GTTGACCCCATTGATGAGTATGCCATGACGCAACTCAAGGAGTTTGAGGGCAAGAAGCTTGTCGACATCACCAAG
GACTTTGAGCTTGAGGAGACTGAAGAGGAGAAGAAGGCTCGTGAGGAGGAGGAGAAGGAGTATGAGAGCTTGGCC
AAGAGCCTGAAGAATGTGCTTGGCGAAAAGGTTGAAAAGGTTGTTGTTAGCCACAAGCTTGGCCTCTGCCCATGC
GCCATTCGCACTGGCCAGTTTGGTTGGTCGGCCAACATGGAGCGCATCATGAAGGCTCAGGCTCTGCGCGACACG
TCGATGAGCAGCTACATGTCGTCCAAGAAGACGTTTGAGATTTCTCCCAAGTCTCCCATTATCCAGGAGCTCAAG
AAGAAGGTTGAGGCGGATGGAGAAAATGACCGCACGGTCAAGTCGATTGTGCAGCTTCTCTTTGAGACGTCGCTG
CTTGTCTCGGGCTTCACAATTGACGAGCCTGCCGGATTTGCCGAGCGCATCCACAAGCTTGTGCAGCTTGGGCTT
AATATTGAGGAGGACGACAATGCTGCCCCGACTGAGGCGGAGGCGGTGGAGACGTCTGCTGCTGCCCCTGCTGCC
GGCGACAGCGCCATGGAGGAGGTTGACTAG
Transcript >OphauB2|955
ATGGCTGAGACTTTCGAGTTCCAGGCTGAGATTTCTCAGCTGCTGTCTCTCATCATCAACACTGTCTACTCCAAC
AAGGAAATTTTCCTCAGAGAGCTCATCTCCAATGCCTCTGATGCTTTGGACAAGATTCGCTACAAGGCCTTGTCG
GATCCTAGTCAGCTTGACAGCGGCAAGGATCTGCGCATCGACATCATTCCCAACAAGGAGGCCAAGACTTTGACC
ATTCGCGACACGGGCATTGGCATGACCAAGGCTGATTTGGTCAACAATCTTGGTACCATTGCACGCTCTGGCACC
AAGCAGTTTATGGAGGCATTGACGGCTGGTGCCGATGTTTCCATGATTGGTCAATTTGGTGTTGGCTTCTACTCT
GCCTACCTTGTTGCCGACCGCGTTAGCGTCATTTCAAAGCACAATGACGACGAGCAGTACATCTGGGAGTCGAGC
GCTGGTGGCACCTTCAACATTACTGCTGATACCAAGGGTGAGCCGCTTGGCCGCGGAACCGCCATTATTCTTCAC
CTCAAGGATGAGCAGGCAGAGTACCTCAATGAGAGCAAGATCAAGGAGGTTATCAAGAAGCACTCCGAGTTTATC
TCTTACCCCATTTACCTTCACGTCACCAAGGAGACTGAGACTGAAGTCCCTGATGAGGATGCCGAGGCTGAAGAG
GTCAAGGAGGATGAGGGTGATGACAAGAAGCCCCGCATTGAAGAGGTTGACGACGAAGACGAGGAAAAGGACAAG
GAGAAGAAGAAGAAGACCAAGAAGATCAAGGAGACCAAGATTGAAGAAGAGGAGCTCAACAAGCAAAAGCCCATC
TGGACTCGCAACCCACAGGACATCACCCAGGAGGAGTATGCTTCCTTTTACAAGTCTCTCTCCAACGACTGGGAG
GACCCTCTTGCCGTCAAGCACTTCTCAGTCGAGGGACAGCTTGAATTCCGCGCCATTCTCTTCGTGCCCAAGCGC
GCACCCTTTGACTTGTTTGAGACCAAGAAGACCAAGAACAACATCAAGCTCTATGTCCGCCGCGTCTTCATTACT
GATGATGCTACTGATCTCATTCCCGAGTGGCTTGGCTTCATCAAGGGCGTTGTCGACTCTGAGGATCTCCCTCTT
AACCTGTCTCGTGAGACTCTTCAGCAAAACAAGATTATGAAGGTGATCAAGAAGAATATTGTCAAGAAGGCTCTT
GAGCTCTTCACGGAGATTTCGGAGGACAAGGAGCAGTTCGACAAGTTTTACAGTGCCTTCTCCAAGAACATCAAG
CTTGGAATCCACGAGGATTCGCAAAACCGTCAAGTCTTGGCCAAGCTTCTACGCTTCAACTCGACCAAGTCTGGC
GATGAAATGACATCGCTTGCCGACTATGTCACTCGCATGCCTGAGCACCAGAATAACATGTACTACATTACGGGC
GAGTCCATCAAGGCTGTGTCAAAGTCGCCCTTCCTTGATACGCTCAAGGACAAAGGCTTCGAGGTGTTGTTCCTG
GTTGACCCCATTGATGAGTATGCCATGACGCAACTCAAGGAGTTTGAGGGCAAGAAGCTTGTCGACATCACCAAG
GACTTTGAGCTTGAGGAGACTGAAGAGGAGAAGAAGGCTCGTGAGGAGGAGGAGAAGGAGTATGAGAGCTTGGCC
AAGAGCCTGAAGAATGTGCTTGGCGAAAAGGTTGAAAAGGTTGTTGTTAGCCACAAGCTTGGCCTCTGCCCATGC
GCCATTCGCACTGGCCAGTTTGGTTGGTCGGCCAACATGGAGCGCATCATGAAGGCTCAGGCTCTGCGCGACACG
TCGATGAGCAGCTACATGTCGTCCAAGAAGACGTTTGAGATTTCTCCCAAGTCTCCCATTATCCAGGAGCTCAAG
AAGAAGGTTGAGGCGGATGGAGAAAATGACCGCACGGTCAAGTCGATTGTGCAGCTTCTCTTTGAGACGTCGCTG
CTTGTCTCGGGCTTCACAATTGACGAGCCTGCCGGATTTGCCGAGCGCATCCACAAGCTTGTGCAGCTTGGGCTT
AATATTGAGGAGGACGACAATGCTGCCCCGACTGAGGCGGAGGCGGTGGAGACGTCTGCTGCTGCCCCTGCTGCC
GGCGACAGCGCCATGGAGGAGGTTGACTAG
Gene >OphauB2|955
ATGGCTGAGACTTTCGAGTTCCAGGCTGAGATTTCTCAGCTGCTGTCTCTCATCATCAACACTGTCTACTCCAAC
AAGGAAATTTTCCTCAGAGAGCTCATCTCCAATGCCTCTGATGCTTTGGACAAGATTCGCTACAAGGCCTTGTCG
GATCCTAGTCAGCTTGACAGCGGCAAGGATCTGCGCATCGACATCATTCCCAACAAGGAGGCCAAGACTTTGACC
ATTCGCGACACGGGCATTGGCATGACCAAGGCTGATTTGGTCAACAATCTTGGTACCATTGCACGCTCTGGCACC
AAGCAGTTTATGGAGGCATTGACGGCTGGTGCCGATGTTTCCATGATTGGTCAATTTGGTGTTGGCTTCTACTCT
GCCTACCTTGTTGCCGACCGCGTTAGCGTCATTTCAAAGCACAATGACGACGAGCAGTACATCTGGGAGTCGAGC
GCTGGTGGCACCTTCAACATTACTGCTGATACCAAGGGTGAGCCGCTTGGCCGCGGAACCGCCATTATTCTTCAC
CTCAAGGATGAGCAGGCAGAGTACCTCAATGAGAGCAAGATCAAGGAGGTTATCAAGAAGCACTCCGAGTTTATC
TCTTACCCCATTTACCTTCACGTCACCAAGGAGACTGAGACTGAAGTCCCTGATGAGGATGCCGAGGCTGAAGAG
GTCAAGGAGGATGAGGGTGATGACAAGAAGCCCCGCATTGAAGAGGTTGACGACGAAGACGAGGAAAAGGACAAG
GAGAAGAAGAAGAAGACCAAGAAGATCAAGGAGACCAAGATTGAAGAAGAGGAGCTCAACAAGCAAAAGCCCATC
TGGACTCGCAACCCACAGGACATCACCCAGGAGGAGTATGCTTCCTTTTACAAGTCTCTCTCCAACGACTGGGAG
GACCCTCTTGCCGTCAAGCACTTCTCAGTCGAGGGACAGCTTGAATTCCGCGCCATTCTCTTCGTGCCCAAGCGC
GCACCCTTTGACTTGTTTGAGACCAAGAAGACCAAGAACAACATCAAGCTCTATGTCCGCCGCGTCTTCATTACT
GATGATGCTACTGATCTCATTCCCGAGTGGCTTGGCTTCATCAAGGGCGTTGTCGACTCTGAGGATCTCCCTCTT
AACCTGTCTCGTGAGACTCTTCAGCAAAACAAGATTATGAAGGTGATCAAGAAGAATATTGTCAAGAAGGCTCTT
GAGCTCTTCACGGAGATTTCGGAGGACAAGGAGCAGTTCGACAAGTTTTACAGTGCCTTCTCCAAGAACATCAAG
CTTGGAATCCACGAGGATTCGCAAAACCGTCAAGTCTTGGCCAAGCTTCTACGCTTCAACTCGACCAAGTCTGGC
GATGAAATGACATCGCTTGCCGACTATGTCACTCGCATGCCTGAGCACCAGAATAACATGTACTACATTACGGGC
GAGTCCATCAAGGCTGTGTCAAAGTCGCCCTTCCTTGATACGCTCAAGGACAAAGGCTTCGAGGTGTTGTTCCTG
GTTGACCCCATTGATGAGTATGCCATGACGCAACTCAAGGAGTTTGAGGGCAAGAAGCTTGTCGACATCACCAAG
GACTTTGAGCTTGAGGAGACTGAAGAGGAGAAGAAGGCTCGTGAGGAGGAGGAGAAGGAGTATGAGAGCTTGGCC
AAGAGCCTGAAGAATGTGCTTGGCGAAAAGGTTGAAAAGGTTGTTGTTAGCCACAAGCTTGGCCTCTGCCCATGC
GCCATTCGCACTGGCCAGTTTGGTTGGTCGGCCAACATGGAGCGCATCATGAAGGCTCAGGCTCTGCGCGACACG
TCGATGAGCAGCTACATGTCGTCCAAGAAGACGTTTGAGATTTCTCCCAAGTCTCCCATTATCCAGGAGCTCAAG
AAGAAGGTTGAGGCGGATGGAGAAAATGACCGCACGGTCAAGTCGATTGTGCAGCTTCTCTTTGAGACGTCGCTG
CTTGTCTCGGGCTTCACAATTGACGAGCCTGCCGGATTTGCCGAGCGCATCCACAAGCTTGTGCAGCTTGGGCTT
AATATTGAGGAGGACGACAATGCTGCCCCGACTGAGGCGGAGGCGGTGGAGACGTCTGCTGCTGCCCCTGCTGCC
GGCGACAGCGCCATGGAGGAGGTTGACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail