Fungal Genomics

at Utrecht University

General Properties

Protein IDOphauB2|950
Gene name
LocationContig_12:278551..280931
Strand+
Gene length (bp)2380
Transcript length (bp)2316
Coding sequence length (bp)2316
Protein length (aa) 772

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9P7P0|YOL4_SCHPO Uncharacterized acyltransferase C1718.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1718.04 PE=1 SV=1 32 628 1.0E-169
sp|P32784|GPT1_YEAST Glycerol-3-phosphate O-acyltransferase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCT1 PE=1 SV=3 1 693 6.0E-157
sp|P36148|GPT2_YEAST Glycerol-3-phosphate O-acyltransferase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GPT2 PE=1 SV=1 13 617 2.0E-132

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 68 0.5

Transmembrane Domains

Domain # Start End Length
1 452 471 19
2 502 521 19
3 536 558 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >OphauB2|950
MQASLMTPLSDEQRSQRSLSATQKELYPMVKWKYDLFLYIFGNLVNLFFREVVPRGSWKVPQSGPVLFVAAPHAN
QFVDAILLQRTLRHQANRRVSLLIAQKSVHGFIGWGSRQVGSVPVGRAQDAAKPATGTIYLPDPVGDPTLIRGVG
TKFGQGQGELHGILLLPPGKNSTGASVEIAEIISPTEMRVKGAFKTKLAMQQLTGRPDIDDEGRLTNPQLRGPAP
GYEGTKFKLAPHIDQTKVYEAVFARLRNGGCVGIFPEGGSHDRTELLPLKAGVAIMALGTLAESPDCGLKIVPVG
MNYFHAHKFRSRAVIEFGTPFEVPRHLVELYRNNQRREAIGQVLDTVHQALSSVTVSAPDYDTLMMIQAARRLYN
PTGRKLPLPVVVELNRRLAMGYERYKDDAHITSLSRSVKEYNSQLRYLNLKDHQVQYARMSILEVLFLFIYRSVK
LVLLFLCTVPGLLLFAPVFVATKIISRKKAKTALAGSTVKIRGRDVMATWKILVALGLAPTIYHFYSVIVTLKVW
HDRLWGTVPGWVPLWVVYFGVWPLMIAITLAALRFGEVGMDIFKSLRPLVLCLLPTSKYSIHTLKVRRAELSAQV
TELINEHGPEMFDDFDKSRLVPDITRVEGAGTGPDGRRRRDSEQSNGFEVESPPSMSRRNTTQSSRALPRNDSFS
NIGAVGIFSTRPPSRSRSRSRSSSAGGGLGSSGFPISAFTTLDSAEGFNEASRKIRQAMKDRRRKSEQLKMEVGD
YESDDEDMDGGEYDEARKKRV*
Coding >OphauB2|950
ATGCAGGCAAGCCTCATGACTCCTCTGAGCGATGAGCAACGATCCCAGCGGTCGTTGTCTGCGACGCAGAAGGAG
CTGTATCCCATGGTCAAGTGGAAGTACGATTTGTTTCTCTACATCTTTGGCAATCTGGTCAATCTCTTCTTCCGC
GAGGTAGTGCCACGAGGCTCGTGGAAAGTGCCGCAGTCAGGGCCAGTCTTGTTTGTCGCAGCCCCTCATGCAAAC
CAATTTGTCGATGCCATCCTCCTTCAGCGCACATTGCGACATCAGGCCAACCGTCGCGTCTCGCTGCTCATTGCC
CAGAAATCAGTCCATGGCTTCATCGGCTGGGGCTCGCGGCAGGTGGGCTCCGTGCCCGTTGGACGGGCTCAGGAC
GCTGCCAAGCCGGCGACGGGCACGATTTACCTGCCCGACCCCGTTGGCGACCCGACACTGATCCGCGGCGTCGGC
ACCAAGTTTGGGCAGGGCCAAGGCGAGCTTCACGGCATACTTCTGCTTCCGCCTGGCAAAAACTCGACGGGGGCT
AGCGTGGAAATTGCAGAGATTATCAGCCCCACCGAGATGCGCGTCAAGGGCGCCTTCAAGACCAAGCTCGCCATG
CAGCAACTGACGGGGCGACCCGATATTGACGACGAGGGCCGATTGACTAATCCGCAGCTCCGTGGCCCGGCGCCG
GGGTACGAGGGCACCAAATTCAAACTGGCTCCTCACATCGACCAGACCAAGGTGTACGAAGCTGTCTTTGCCAGG
CTGCGCAATGGCGGCTGTGTGGGTATTTTCCCCGAGGGCGGCAGCCATGATCGAACCGAGCTGCTTCCCCTCAAG
GCGGGGGTTGCCATTATGGCGCTTGGCACGCTGGCTGAATCACCCGACTGCGGACTCAAGATTGTGCCAGTGGGC
ATGAACTACTTTCACGCGCACAAATTCCGCTCTCGTGCCGTCATCGAGTTTGGAACGCCCTTTGAAGTTCCTCGT
CACCTGGTAGAGCTTTACCGCAACAATCAACGCCGCGAGGCCATTGGCCAGGTCCTCGACACTGTGCACCAGGCC
CTCAGCTCCGTCACCGTATCGGCGCCCGACTATGACACGCTCATGATGATCCAGGCGGCGCGTCGTCTTTACAAT
CCTACTGGACGCAAGCTGCCGCTGCCCGTCGTCGTTGAGCTCAACCGGCGTCTAGCCATGGGCTATGAACGATAC
AAGGATGATGCGCATATCACTTCGCTGTCCCGCTCTGTCAAGGAGTACAACTCACAACTGCGATACCTGAACCTC
AAGGATCACCAAGTGCAGTATGCGCGCATGTCCATATTGGAGGTCTTGTTCCTCTTCATCTACCGCTCCGTGAAG
CTAGTACTGCTCTTTCTCTGCACTGTGCCCGGCCTGTTGCTATTTGCCCCCGTTTTTGTCGCAACCAAGATTATT
AGCCGCAAAAAGGCCAAGACGGCACTGGCTGGGTCGACGGTCAAGATCCGCGGTCGCGACGTCATGGCGACGTGG
AAAATTCTCGTTGCTCTCGGCCTGGCACCAACCATTTATCATTTCTACTCGGTCATTGTCACACTCAAGGTGTGG
CATGACAGGCTCTGGGGCACTGTGCCTGGATGGGTACCTCTTTGGGTTGTCTACTTTGGCGTATGGCCCCTTATG
ATTGCCATTACGCTGGCGGCGCTGCGCTTCGGCGAGGTTGGCATGGACATCTTCAAGTCACTAAGGCCATTGGTG
CTTTGTCTGCTGCCCACCTCCAAATACAGTATTCATACACTCAAAGTGCGACGAGCAGAATTGAGTGCCCAAGTT
ACGGAGCTCATCAATGAACATGGGCCAGAAATGTTTGACGACTTTGACAAGTCGCGTCTGGTGCCGGATATAACG
CGTGTGGAGGGCGCTGGGACGGGACCAGATGGACGCCGGCGTCGCGACAGCGAGCAGTCCAATGGCTTCGAGGTG
GAGTCGCCGCCCTCAATGTCGCGCCGTAACACGACGCAGTCGAGCCGGGCCTTGCCACGAAACGACTCATTCAGT
AATATTGGAGCAGTTGGAATCTTCTCGACGCGACCGCCGTCGCGCTCACGCAGTCGGTCGCGATCTAGCAGTGCG
GGTGGCGGCTTGGGCTCGAGTGGCTTTCCCATTAGCGCATTCACGACACTCGATTCAGCCGAGGGATTCAACGAG
GCGAGCAGAAAGATTCGGCAGGCAATGAAGGATCGGCGGAGGAAGTCGGAACAGCTCAAGATGGAGGTGGGAGAT
TACGAAAGCGATGACGAGGACATGGACGGAGGCGAGTATGACGAGGCAAGGAAAAAGAGGGTTTGA
Transcript >OphauB2|950
ATGCAGGCAAGCCTCATGACTCCTCTGAGCGATGAGCAACGATCCCAGCGGTCGTTGTCTGCGACGCAGAAGGAG
CTGTATCCCATGGTCAAGTGGAAGTACGATTTGTTTCTCTACATCTTTGGCAATCTGGTCAATCTCTTCTTCCGC
GAGGTAGTGCCACGAGGCTCGTGGAAAGTGCCGCAGTCAGGGCCAGTCTTGTTTGTCGCAGCCCCTCATGCAAAC
CAATTTGTCGATGCCATCCTCCTTCAGCGCACATTGCGACATCAGGCCAACCGTCGCGTCTCGCTGCTCATTGCC
CAGAAATCAGTCCATGGCTTCATCGGCTGGGGCTCGCGGCAGGTGGGCTCCGTGCCCGTTGGACGGGCTCAGGAC
GCTGCCAAGCCGGCGACGGGCACGATTTACCTGCCCGACCCCGTTGGCGACCCGACACTGATCCGCGGCGTCGGC
ACCAAGTTTGGGCAGGGCCAAGGCGAGCTTCACGGCATACTTCTGCTTCCGCCTGGCAAAAACTCGACGGGGGCT
AGCGTGGAAATTGCAGAGATTATCAGCCCCACCGAGATGCGCGTCAAGGGCGCCTTCAAGACCAAGCTCGCCATG
CAGCAACTGACGGGGCGACCCGATATTGACGACGAGGGCCGATTGACTAATCCGCAGCTCCGTGGCCCGGCGCCG
GGGTACGAGGGCACCAAATTCAAACTGGCTCCTCACATCGACCAGACCAAGGTGTACGAAGCTGTCTTTGCCAGG
CTGCGCAATGGCGGCTGTGTGGGTATTTTCCCCGAGGGCGGCAGCCATGATCGAACCGAGCTGCTTCCCCTCAAG
GCGGGGGTTGCCATTATGGCGCTTGGCACGCTGGCTGAATCACCCGACTGCGGACTCAAGATTGTGCCAGTGGGC
ATGAACTACTTTCACGCGCACAAATTCCGCTCTCGTGCCGTCATCGAGTTTGGAACGCCCTTTGAAGTTCCTCGT
CACCTGGTAGAGCTTTACCGCAACAATCAACGCCGCGAGGCCATTGGCCAGGTCCTCGACACTGTGCACCAGGCC
CTCAGCTCCGTCACCGTATCGGCGCCCGACTATGACACGCTCATGATGATCCAGGCGGCGCGTCGTCTTTACAAT
CCTACTGGACGCAAGCTGCCGCTGCCCGTCGTCGTTGAGCTCAACCGGCGTCTAGCCATGGGCTATGAACGATAC
AAGGATGATGCGCATATCACTTCGCTGTCCCGCTCTGTCAAGGAGTACAACTCACAACTGCGATACCTGAACCTC
AAGGATCACCAAGTGCAGTATGCGCGCATGTCCATATTGGAGGTCTTGTTCCTCTTCATCTACCGCTCCGTGAAG
CTAGTACTGCTCTTTCTCTGCACTGTGCCCGGCCTGTTGCTATTTGCCCCCGTTTTTGTCGCAACCAAGATTATT
AGCCGCAAAAAGGCCAAGACGGCACTGGCTGGGTCGACGGTCAAGATCCGCGGTCGCGACGTCATGGCGACGTGG
AAAATTCTCGTTGCTCTCGGCCTGGCACCAACCATTTATCATTTCTACTCGGTCATTGTCACACTCAAGGTGTGG
CATGACAGGCTCTGGGGCACTGTGCCTGGATGGGTACCTCTTTGGGTTGTCTACTTTGGCGTATGGCCCCTTATG
ATTGCCATTACGCTGGCGGCGCTGCGCTTCGGCGAGGTTGGCATGGACATCTTCAAGTCACTAAGGCCATTGGTG
CTTTGTCTGCTGCCCACCTCCAAATACAGTATTCATACACTCAAAGTGCGACGAGCAGAATTGAGTGCCCAAGTT
ACGGAGCTCATCAATGAACATGGGCCAGAAATGTTTGACGACTTTGACAAGTCGCGTCTGGTGCCGGATATAACG
CGTGTGGAGGGCGCTGGGACGGGACCAGATGGACGCCGGCGTCGCGACAGCGAGCAGTCCAATGGCTTCGAGGTG
GAGTCGCCGCCCTCAATGTCGCGCCGTAACACGACGCAGTCGAGCCGGGCCTTGCCACGAAACGACTCATTCAGT
AATATTGGAGCAGTTGGAATCTTCTCGACGCGACCGCCGTCGCGCTCACGCAGTCGGTCGCGATCTAGCAGTGCG
GGTGGCGGCTTGGGCTCGAGTGGCTTTCCCATTAGCGCATTCACGACACTCGATTCAGCCGAGGGATTCAACGAG
GCGAGCAGAAAGATTCGGCAGGCAATGAAGGATCGGCGGAGGAAGTCGGAACAGCTCAAGATGGAGGTGGGAGAT
TACGAAAGCGATGACGAGGACATGGACGGAGGCGAGTATGACGAGGCAAGGAAAAAGAGGGTTTGA
Gene >OphauB2|950
ATGCAGGCAAGCCTCATGACTCCTCTGAGCGATGAGCAACGATCCCAGCGGTCGTTGTCTGCGACGCAGAAGGAG
CTGTATCCCATGGTCAAGTGGAAGTACGATTTGTTTCTCTACATCTTTGGCAATCTGGTCAATCTCTTCTTCCGC
GAGGTAGTGCCACGAGGCTCGTGGAAAGTGCCGCAGTCAGGGCCAGTCTTGTTTGTCGCAGCCCCTCATGCAAAC
CAAGTAAGCAGACAGCGCCGTGCTGGCCTAATGAGAGACACAGCAGCTAATGACATGGGCTGGGTAGTTTGTCGA
TGCCATCCTCCTTCAGCGCACATTGCGACATCAGGCCAACCGTCGCGTCTCGCTGCTCATTGCCCAGAAATCAGT
CCATGGCTTCATCGGCTGGGGCTCGCGGCAGGTGGGCTCCGTGCCCGTTGGACGGGCTCAGGACGCTGCCAAGCC
GGCGACGGGCACGATTTACCTGCCCGACCCCGTTGGCGACCCGACACTGATCCGCGGCGTCGGCACCAAGTTTGG
GCAGGGCCAAGGCGAGCTTCACGGCATACTTCTGCTTCCGCCTGGCAAAAACTCGACGGGGGCTAGCGTGGAAAT
TGCAGAGATTATCAGCCCCACCGAGATGCGCGTCAAGGGCGCCTTCAAGACCAAGCTCGCCATGCAGCAACTGAC
GGGGCGACCCGATATTGACGACGAGGGCCGATTGACTAATCCGCAGCTCCGTGGCCCGGCGCCGGGGTACGAGGG
CACCAAATTCAAACTGGCTCCTCACATCGACCAGACCAAGGTGTACGAAGCTGTCTTTGCCAGGCTGCGCAATGG
CGGCTGTGTGGGTATTTTCCCCGAGGGCGGCAGCCATGATCGAACCGAGCTGCTTCCCCTCAAGGCGGGGGTTGC
CATTATGGCGCTTGGCACGCTGGCTGAATCACCCGACTGCGGACTCAAGATTGTGCCAGTGGGCATGAACTACTT
TCACGCGCACAAATTCCGCTCTCGTGCCGTCATCGAGTTTGGAACGCCCTTTGAAGTTCCTCGTCACCTGGTAGA
GCTTTACCGCAACAATCAACGCCGCGAGGCCATTGGCCAGGTCCTCGACACTGTGCACCAGGCCCTCAGCTCCGT
CACCGTATCGGCGCCCGACTATGACACGCTCATGATGATCCAGGCGGCGCGTCGTCTTTACAATCCTACTGGACG
CAAGCTGCCGCTGCCCGTCGTCGTTGAGCTCAACCGGCGTCTAGCCATGGGCTATGAACGATACAAGGATGATGC
GCATATCACTTCGCTGTCCCGCTCTGTCAAGGAGTACAACTCACAACTGCGATACCTGAACCTCAAGGATCACCA
AGTGCAGTATGCGCGCATGTCCATATTGGAGGTCTTGTTCCTCTTCATCTACCGCTCCGTGAAGCTAGTACTGCT
CTTTCTCTGCACTGTGCCCGGCCTGTTGCTATTTGCCCCCGTTTTTGTCGCAACCAAGATTATTAGCCGCAAAAA
GGCCAAGACGGCACTGGCTGGGTCGACGGTCAAGATCCGCGGTCGCGACGTCATGGCGACGTGGAAAATTCTCGT
TGCTCTCGGCCTGGCACCAACCATTTATCATTTCTACTCGGTCATTGTCACACTCAAGGTGTGGCATGACAGGCT
CTGGGGCACTGTGCCTGGATGGGTACCTCTTTGGGTTGTCTACTTTGGCGTATGGCCCCTTATGATTGCCATTAC
GCTGGCGGCGCTGCGCTTCGGCGAGGTTGGCATGGACATCTTCAAGTCACTAAGGCCATTGGTGCTTTGTCTGCT
GCCCACCTCCAAATACAGTATTCATACACTCAAAGTGCGACGAGCAGAATTGAGTGCCCAAGTTACGGAGCTCAT
CAATGAACATGGGCCAGAAATGTTTGACGACTTTGACAAGTCGCGTCTGGTGCCGGATATAACGCGTGTGGAGGG
CGCTGGGACGGGACCAGATGGACGCCGGCGTCGCGACAGCGAGCAGTCCAATGGCTTCGAGGTGGAGTCGCCGCC
CTCAATGTCGCGCCGTAACACGACGCAGTCGAGCCGGGCCTTGCCACGAAACGACTCATTCAGTAATATTGGAGC
AGTTGGAATCTTCTCGACGCGACCGCCGTCGCGCTCACGCAGTCGGTCGCGATCTAGCAGTGCGGGTGGCGGCTT
GGGCTCGAGTGGCTTTCCCATTAGCGCATTCACGACACTCGATTCAGCCGAGGGATTCAACGAGGCGAGCAGAAA
GATTCGGCAGGCAATGAAGGATCGGCGGAGGAAGTCGGAACAGCTCAAGATGGAGGTGGGAGATTACGAAAGCGA
TGACGAGGACATGGACGGAGGCGAGTATGACGAGGCAAGGAAAAAGAGGGTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail